KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16901Help
Entry
Dmel_CG16901      CDS       T00030                                 

Gene name
sqd
Definition
squid
Orthology
K03102  
squid
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG16901 (sqd)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    Dmel_CG16901 (sqd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:87F5-87F6
AA seq 308 aa AA seqDB search
MAENKQVDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFV
GGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHI
INSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFC
FITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGG
RGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYGGGGFNGGKQRGGGG
RQQRHQPY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacaagcaagtggatacagaaataaacggcgaggatttcaccaaggacgtg
actgccgacggtccgggatctgaaaatggtgatgcgggcgccgccggctcgaccaacggc
agttcggacaaccaatcggccgcatccggccagcgggacgacgacaggaaactgtttgtc
ggtggtctgagctgggaaacgactgagaaggaactccgcgatcacttcggcaaatatggc
gagatcgagagcatcaatgtcaagacagatccccagaccggtcggtcccgaggattcgcc
ttcatcgtgtttacaaacaccgaggccattgacaaagtcagcgccgcggatgagcacata
atcaacagcaagaaggtcgatcccaagaaggccaaggccaggcacggcaagatctttgtc
ggcggcctcaccacagagatcagcgatgaggagattaagacctactttggacagttcggc
aatatcgtcgaggtggagatgccattcgacaagcaaaagtcgcagcgcaaaggattctgc
ttcatcaccttcgattcggagcaggtggtgacagatttgctgaagacgcccaagcagaag
atcgccggcaaggaggtcgatgttaagcgtgcgacgcccaagccggagaaccagatgatg
ggcggtatgcgtggtggaccacgcggtggtatgcgcggcggacgcggtggctacggagga
cgaggtggctacaacaaccagtgggacggacagggatcatacggcggctatggcggcggc
tacggcggatatggtgccggtggttatggcgactactatgccggcggctactataatgga
tatgactacggttatggcggtggcggttttaacggtggcaagcagcgcggaggcggtgga
cgccagcagcggcatcagccctactaa

DBGET integrated database retrieval system