KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17010Help
Entry
Dmel_CG17010      CDS       T00030                                 

Definition
CG17010 gene product from transcript CG17010-RA (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dmel_CG17010
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dmel_CG17010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:33E1-33E1
AA seq 429 aa AA seqDB search
MGKKLDVVVFGTANIEYITYVPELPKPGELVAGTYMETCFGGKGANQCVAAAKLGASTVL
VAKLGKDESGDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGDQYKINVAGANVFL
TAKDVTRAKKSFQDAKVLLCQLETDMNATMCALRQFKGVSLLHMSPMRKDIPNAMIGLPT
ILVANQEAAANLTDMEEVLTPDQARKAAETLIAKGAKSVIITMGEQGAVYMSKKSKDMCT
HVPASDVPHLADPSGAGDAFMGSLAYHIARFPKLSTEHHISAAHSCAAYSMGRRGTQPSF
PGKESAKSDLCYSTPTFSVIPPSSPQHEDDNMVTKTPPPSMVVPTPEEAHSQKEVVEEPQ
KPAPPPPEDPVVEAPPPTTSEEPPKAVETSNEPPKPAETTDEPPKPAETADQAPVKPVET
ANEPPANKA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagctggatgtggttgtcttcgggacggcaaacatcgaatatataacatat
gtcccggaattgccgaaacccggtgaacttgtcgccggaacgtacatggagacctgtttc
ggtggcaagggagccaatcagtgtgtggcagctgccaaattgggggcctccaccgtcctg
gtcgccaagttgggcaaggacgaatcgggcgatgactacctaaaccacctgcaacagcac
gaggttgatgtgacgcacgtccagcaggtggagaacaatcccacgggcatgagtgaaatc
gcggtttctgagaatggagatcagtacaagatcaacgtggctggtgcgaatgtatttctc
acggccaaggatgtgacccgggctaagaagtcctttcaggatgcgaaggtgcttctctgc
caactggaaacggatatgaatgccaccatgtgtgcgttgcgtcagttcaagggggtttcc
ctgctccacatgtcgccaatgcgaaaagatattccaaatgccatgattggcttgcctact
attctggttgcgaatcaagaggcagctgccaacctaaccgatatggaagaagtgttaacc
cctgatcaggcgcgaaaagcagctgaaactcttatcgcaaagggagccaagagcgtgatc
attaccatgggcgagcaaggagccgtttacatgtccaagaagagcaaagatatgtgcacc
catgtgcccgcctccgatgtgccgcacttggccgatccctcgggtgccggtgatgccttt
atgggcagcttggcctatcacatagctcgatttcccaaactgtccacagaacatcatatc
agtgcggcacactcctgcgccgcctactccatgggccgccgcggcactcagccaagtttt
ccgggcaaggaaagcgccaaaagtgacctatgctattcgacgcccacgtttagtgtcatt
ccaccttctagtccgcaacatgaagatgataatatggtaacaaagacgccaccgccttca
atggtagtccctacgcccgaagaagcacactcccaaaaggaagttgtggaagaaccgcaa
aaacctgcacctcctccaccggaggatccggttgtggaagcacctccaccaacgacctcc
gaggaacctccgaaagcagtggaaacctccaatgaacctccaaagcctgcggagaccact
gatgaacctccaaagcctgcggagaccgcagatcaagctcctgtgaaacccgtggagact
gctaatgagccacctgccaacaaagcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system