KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17077Help
Entry
Dmel_CG17077      CDS       T00030                                 

Gene name
pnt
Definition
(RefSeq) pointed
  KO
K02678  
c-ets proto-oncogene protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG17077 (pnt)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG17077 (pnt)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    Dmel_CG17077 (pnt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:94E9-94E13; 3R:3-79.0 cM
AA seq 718 aa AA seqDB search
MELAICKTDLSATKFMLPPALPSSAAIGSSSAVASTASHFLDKAAHELFQLNAINGHLFK
SPASSHLNSVGSPSILSQLNGIGNSGNHSGQVSTMRLKKNRKVTFLSSLVESKNIFIKEE
PIHGCKDLCSLSDISDHEASLEVPTALPPLTPGTNRKVNEVLKASFASWEKEVQKCNITK
DPREWTEEHVIYWLNWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLAITPPFTGDILW
EHLDILQKDCEKPNEDIVHGNSFESATTASVCGSDHQVANYPNETHANSNNSSINSRLSM
DYVTSAGNSDNKNFHRATPHSHNGYNTSNTHDRINNSTPPQQQQSQQPTVNGSGSASSNN
NNSMLPPAVQQSNNENNNTSSSNTNNSSNNNNNSGGSNNSNAGSNNNNNNNNNINFMAAA
AIFQHHLKEEPGTQNGNIGGYGGGSNSQNDPTDLSSYGLPAHLAAYGGGSGSGPTGGRSS
GGGGDESDYHSTISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRF
HDGYPPEFTPYDAQSFQSMGPQPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQGG
VPCFTGSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMN
YEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHTPEELVAKYDLKIEKKDVD
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggaattggcgatttgtaaaacagatctgtctgccacgaaatttatgctgccgcccgct
ttgccctcctcagcggccattggttcctcgtcggcggtcgcctccacggcctcgcatttc
ctggataaggcggcccacgagctctttcaactgaacgccatcaacggacacctgttcaag
tcgccggccagcagccacctcaattcggtcggcagtccgtcgatacttagccaattgaac
ggcatcggcaacagcggcaaccattcgggccaagttagcaccatgaggctcaagaagaac
cgcaaagtcacctttctgtccagcctagttgagtcgaaaaatattttcatcaaggaggag
ccgatccatggatgcaaggatctgtgcagtttgtcggatatttcagatcatgaggcatca
ttagaagttcccaccgccttgccacccctcacgccgggcaccaatcgcaaggtcaacgag
gtactgaaggcatcctttgcctcctgggaaaaggaggtccaaaaatgcaacataaccaaa
gatccgcgtgaatggacggaggagcatgtcatctactggctcaattgggctaaaaatgag
ttctcattggtctccatgaacctggaccccttctacaagatgaagggacgcgccatggtg
gatctgggcaaggagaagttcctggccatcacgccgcccttcaccggcgacatactgtgg
gagcacttggacatcctgcaaaaagattgcgagaaaccaaatgaggatattgtgcacggc
aattcctttgagtcggccaccacggcctcggtctgtggatcggaccaccaggtggccaat
taccccaacgagacgcacgccaacagcaacaacagcagcataaacagccgcctgtccatg
gattatgtgacgtcggcggggaatagtgataataaaaacttccaccgcgccacgccccac
tcccacaatggctacaacaccagcaacacacacgaccgcatcaacaacagcacgcccccg
cagcagcagcaatcgcagcagccgactgtcaatggcagcggtagcgccagcagcaacaac
aataactccatgctaccgcccgctgtacagcaaagcaacaacgaaaataacaacaccagc
agcagcaacacaaacaacagcagcaacaacaacaacaacagcggtggcagcaacaattcg
aatgcgggcagcaataacaacaataataacaacaataatattaactttatggcagcggcg
gcgatcttccaacatcacctcaaagaggagccgggcacccagaatggtaatatcggtggc
tatggtggtggcagtaatagccagaacgatcccacggatctcagtagttatggattgccc
gcccacctggccgcttacggtggtgggagtggcagtgggccaaccggcggcaggagctcc
ggtggcggtggcgatgaaagcgattatcacagcacgatctcggcgcaggatcaccagagt
cagcaatcgagtggaggaaatggcagtggaggagccagcggtggaagcaccggaaacagc
aacggttacttggacagcagctcggagttctatggcagttacgcgggcaggaatcgattc
cacgatggttatccaccggaatttacgccctatgatgctcaatccttccagtcgatgggc
ccccagcccacggccatggatcagtggggagcagcccatgcccaccagcatccggcagcg
tatatgagcaccttgggtctggataagggcctgctgggtggctatacgacgcagggcgga
gtgccgtgcttcacgggatcgggtcccattcaactgtggcaattcctgctcgaattgctg
ctggacaagacgtgtcagagtttcatttcgtggaccggcgatggctgggagttcaagcta
acagatcctgatgaggtggctcgtcgttggggaattcgcaaaaacaaaccgaagatgaac
tacgagaagctgagtcgcggtctgcgctactattatgacaaaaacatcatccacaagacg
gcaggcaaacgatatgtctaccgctttgtctgtgatctccagaatctagttgggcacaca
cccgaggagctggtggccaagtatgatcttaagattgagaaaaaagatgtggattag

DBGET integrated database retrieval system