KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17077Help
Entry
Dmel_CG17077      CDS       T00030                                 

Gene name
pnt
Definition
pointed
Orthology
K02678  
c-ets proto-oncogene protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:dme04013]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dme04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:94E9-94E13; 3R:3-79.0 cM
AA seq 625 aa AA seqDB search
MPPSAFLVNASIISAANALDSDKEQQLQEHLNQSHFTSSSSSSNSSNNNNCHTAPNYNMV
LQSYENYPSYHLAQHHHHHHHHHSHPHHQLAQQTGLHSHHTMQQQLQQQQQSLLLQHPQQ
QQQQHSHQSQQQQQHGYGSSAQLPHHRLSGGSTGSTTTTSSGSSSSGSSSSASSQGFANG
SATANNLVGALSSSTAASLGLGYFNDMAPFVGDANAYYTDSDVNFFSSGTGYNTSNTHDR
INNSTPPQQQQSQQPTVNGSGSASSNNNNSMLPPAVQQSNNENNNTSSSNTNNSSNNNNN
SGGSNNSNAGSNNNNNNNNNINFMAAAAIFQHHLKEEPGTQNGNIGGYGGGSNSQNDPTD
LSSYGLPAHLAAYGGGSGSGPTGGRSSGGGGDESDYHSTISAQDHQSQQSSGGNGSGGAS
GGSTGNSNGYLDSSSEFYGSYAGRNRFHDGYPPEFTPYDAQSFQSMGPQPTAMDQWGAAH
AHQHPAAYMSTLGLDKGLLGGYTTQGGVPCFTGSGPIQLWQFLLELLLDKTCQSFISWTG
DGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDL
QNLVGHTPEELVAKYDLKIEKKDVD
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctctgcgtttttagtgaatgccagcataatcagtgccgccaacgccttggac
agcgataaggagcagcagcttcaggagcatctcaatcagagtcacttcaccagcagcagc
agcagcagcaacagcagcaacaataacaattgccacacggcgcccaactacaacatggtc
ctgcaaagctatgagaactatcccagctaccacctggctcagcatcatcatcatcatcat
catcaccacagccatccgcatcaccaattggcgcagcagacagggctgcacagccatcat
acgatgcaacagcagctgcagcagcagcagcaatccctactcctgcaacacccgcaacaa
cagcagcagcagcacagccaccagtcgcaacagcagcagcaacacggatacggatcatca
gcccagctgccccatcatcgtttatccggcggcagtacgggcagcaccaccaccacctcc
tccggctccagttcgagtggctcctcgtcgagtgcctcatcgcagggattcgccaacggg
agcgcgactgcgaacaatctggtgggggcgttgagcagctccacggctgcttcgctggga
ctgggctacttcaatgatatggcgccctttgtgggcgatgcgaatgcctactacacggac
tcggatgtcaacttctttagttcaggtacaggctacaacaccagcaacacacacgaccgc
atcaacaacagcacgcccccgcagcagcagcaatcgcagcagccgactgtcaatggcagc
ggtagcgccagcagcaacaacaataactccatgctaccgcccgctgtacagcaaagcaac
aacgaaaataacaacaccagcagcagcaacacaaacaacagcagcaacaacaacaacaac
agcggtggcagcaacaattcgaatgcgggcagcaataacaacaataataacaacaataat
attaactttatggcagcggcggcgatcttccaacatcacctcaaagaggagccgggcacc
cagaatggtaatatcggtggctatggtggtggcagtaatagccagaacgatcccacggat
ctcagtagttatggattgcccgcccacctggccgcttacggtggtgggagtggcagtggg
ccaaccggcggcaggagctccggtggcggtggcgatgaaagcgattatcacagcacgatc
tcggcgcaggatcaccagagtcagcaatcgagtggaggaaatggcagtggaggagccagc
ggtggaagcaccggaaacagcaacggttacttggacagcagctcggagttctatggcagt
tacgcgggcaggaatcgattccacgatggttatccaccggaatttacgccctatgatgct
caatccttccagtcgatgggcccccagcccacggccatggatcagtggggagcagcccat
gcccaccagcatccggcagcgtatatgagcaccttgggtctggataagggcctgctgggt
ggctatacgacgcagggcggagtgccgtgcttcacgggatcgggtcccattcaactgtgg
caattcctgctcgaattgctgctggacaagacgtgtcagagtttcatttcgtggaccggc
gatggctgggagttcaagctaacagatcctgatgaggtggctcgtcgttggggaattcgc
aaaaacaaaccgaagatgaactacgagaagctgagtcgcggtctgcgctactattatgac
aaaaacatcatccacaagacggcaggcaaacgatatgtctaccgctttgtctgtgatctc
cagaatctagttgggcacacacccgaggagctggtggccaagtatgatcttaagattgag
aaaaaagatgtggattag

DBGET integrated database retrieval system