KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17148Help
Entry
Dmel_CG17148      CDS       T00030                                 

Gene name
Est-P
Definition
Esterase P (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dmel_CG17148 (Est-P)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dmel_CG17148 (Est-P)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:69A1-69A1; 3L:3-35.9 cM
AA seq 544 aa AA seqDB search
MSIFKRLLCLTLLWIAALESEADPLIVEITNGKIRGKDNGLYYSYESIPNAEHPTGALRF
EAPQPYSHHWTDVFNATQSPVECMQWNQFINENNKLMGDEDCLTVSIYKPKKPNRSSFPV
VVLLHGGAFMFGSGSIYGHDSIMREGTLLVVKISFGLGPLGFASTGDRHLPGNYGLKDQR
LALQWIKKNIAHFGGMPDNIVLIGHSAGGASAHLQLLHEDFKHLAKGAISVSGNALDPWV
IQQGGRRRAFELGRIVGCGHTNVSAELKDCLKSKPASDIVSAVRSFLVFSYVPFSAFGPV
VEPSDAPDAFLTEDPRAVIKSGKFAQVPWAVTYTTEDGGYNAAQLLERNKLTGESWIDLL
NDRWFDWAPYLLFYRDAKKTIKDMDDLSFDLRQQYLADRRFSVESYWNVQRMFTDVLFKN
SVPSAIDLHRKYGKSPVYSFVYDNPTDSGVGQLLSNRTDVHFGTVHGDDFFLIFNTAAYR
TGIRPDEEVISKKFIGMLEDFALNDKGTLTFGECNFQNNVNSKEYQVLRISRNACKNEEY
ARFP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattcaaacggctgttgtgcctgactttgctgtggatagcagctttagaatct
gaagctgatcccttgattgttgagataacaaatggaaaaatccgtggcaaagataatggg
ttgtactacagctacgaatcgattcccaatgccgagcatccaactggtgccctccgtttt
gaagcacctcagccgtatagtcatcattggactgatgttttcaatgccacgcagtctcca
gttgagtgcatgcagtggaatcagtttataaacgaaaacaataagctgatgggtgatgag
gattgcttaacggtaagcatctataagccaaagaaacccaatcggagcagctttcctgtc
gtagtactcctgcatggaggtgctttcatgttcggtagtggatccatatatggacacgac
tccattatgcgtgagggaactttgcttgtggtaaaaataagttttggtcttggaccattg
ggttttgcaagtaccggcgatagacacttgccgggaaactatggtctaaaggatcaacgt
ctggccctacaatggatcaagaagaacattgctcactttggtggaatgccagataatatt
gtgctcattggtcactctgcaggcggtgcttcggctcatttgcagctgttgcacgaggat
ttcaaacatttggccaaaggagcgatttcggtgagcggcaatgcattggatccttgggtc
atacagcagggtggacgacgacgtgcatttgaactgggtcgtattgtcggttgtggacac
acaaatgtctccgcagaactcaaggactgcttgaagtctaagccggctagcgatatagtc
tctgctgtccgaagcttccttgtgttttcctatgtacccttcagtgcttttggacctgtt
gtggagccgtcagatgcaccagacgcctttctaaccgaggacccaagagcagtgattaag
agcgggaagtttgcccaagtcccttgggctgtgacgtacaccactgaggacgggggatac
aacgctgctcagctgttggaaagaaacaaattaactggcgagagttggattgacctactc
aatgatcgatggtttgattgggcaccatacttgctcttctatcgggacgccaagaaaacc
atcaaagatatggatgatctttcatttgatctcaggcagcagtatctagcagatcggcga
ttcagtgtggaaagttattggaacgtgcagcgaatgtttactgatgttcttttcaagaat
agcgtgccaagtgcaatagatcttcaccgaaagtatggcaaaagtccggtttattctttt
gtctacgataatcctaccgattccggagtgggtcaattgctttccaatcgaacagatgta
cattttggtactgtccacggagatgactttttcttgattttcaatacagctgcataccgt
accggcattcgtccggatgaagaagttatttcaaaaaagtttataggtatgctggaggat
ttcgcactcaacgataagggaacattaacatttggagaatgtaatttccaaaataatgtg
aacagcaaggaatatcaagtgctgcgtatttcacgaaacgcttgtaaaaacgaggaatat
gctcggtttccctaa

DBGET integrated database retrieval system