KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17200Help
Entry
Dmel_CG17200      CDS       T00030                                 

Gene name
Ugt86Dg
Definition
CG17200 gene product from transcript CG17200-RB (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG17200 (Ugt86Dg)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG17200 (Ugt86Dg)
   00500 Starch and sucrose metabolism
    Dmel_CG17200 (Ugt86Dg)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG17200 (Ugt86Dg)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG17200 (Ugt86Dg)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG17200 (Ugt86Dg)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG17200 (Ugt86Dg)
   00983 Drug metabolism - other enzymes
    Dmel_CG17200 (Ugt86Dg)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG17200 (Ugt86Dg)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG17200 (Ugt86Dg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:86D5-86D5
AA seq 527 aa AA seqDB search
MLASGLFYLIILLFPGFLYGARILALFPVPSHSHYYHALPYLKNLASLGHEITSVSPFPS
EEPVKNIYDIYVPEVLNSFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREI
LRPGKAQFDLIIVDIWKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQSP
SSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEISQDIA
LVLVNQHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEHGVIYFSLGTNV
RTKNMVDDRKRILIEAFGSLPQRVLWKFEDEELQDIPSNVLVRKWLPQQDLLAHPKVKLF
ITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHIKKHGFCLSLNYHDMTSDELKATILQ
LLTEKRFEVTARIAGARYRDQPMKPLETAVWWTHYVLRHKGAPHMRVAGRKLSFFTHHSL
DVLGTVLLVILLVIIAILLIIVFSVCKISKNISTRLVVKKQRKQKVR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggcatcgggcttgttttaccttataattttactatttcctggtttcttgtatgga
gctcgaattttggctttgtttccggttccctcccattcgcactattatcatgcccttcca
tatctcaaaaacttggcctctttgggtcacgaaataacttcagtaagtccatttccatct
gaagaaccagtgaaaaatatatacgacatttatgttccggaagtgttaaatagttttgac
gaactattgaaacaaatgacaaccccgaaaaacacgtgggagttcttcgacgcaaccaat
gaatttgtgtataatattactaaagatgtatttaataacgacggagtgcgacgagagata
ctcaggccgggaaaggctcagtttgatctgattattgtggacatatggaagtacgatgct
ttttatagccttgccgcctattttgaggctccaattatcggattagctccctgtggaatc
gattggaaaatagacgaaatggttggtaatccatcgccgatgtcctatcttcagtcgccc
tcatcttacctttacaacctggatacttttgggggtcgcgtggcacacgttgtggaagtc
gccatttcttggttcaactggcactggcgttatgagcaaaagcatgaggcactttacaaa
aagtatttcccaaaaatagctgaaacaaagccactgtctgaaattagccaagacattgct
ttagttttggtaaatcaacatttcacattgggtccaccacgtccgtatgttccgaatgta
atcgaagttggtggtatgcatattgatgaacaacctaaagctttagcccaggatctggag
gactttatccaaggttctggtgagcatggtgtaatttacttttctctgggcaccaatgta
aggacgaaaaatatggtagatgaccgcaagagaatattgatagaagcctttggcagcctg
ccacaacgcgtcttgtggaaattcgaggatgaagagctgcaggatataccgtcgaatgtt
ctagtacgcaaatggttaccgcaacaggacctactggcccacccaaaagtgaaactcttt
ataacccacggaggtatgcagagcaccattgagagcattcactatggtaagcccatgctg
ggattgcccttcttctacgaccaatttaccaatgtggatcacatcaaaaaacatggcttt
tgcctgtctttgaactatcatgatatgacaagtgatgagttgaaggccacaatactccag
ttgctgacggagaagagatttgaggtcacggcaaggatagcaggtgctcgctatcgagat
caaccaatgaagcctttggagacagctgtctggtggactcactacgtcctgcgtcacaag
ggagcacctcatatgcgggtggccgggagaaaattgagcttcttcacccaccacagtctg
gatgtcttgggcactgttcttcttgttattttgcttgttatcattgccattcttcttatt
attgtttttagtgtttgtaagatttctaagaatatctcaacgcgtttagttgttaaaaaa
caacgaaagcagaaagttcgttag

DBGET integrated database retrieval system