KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1721Help
Entry
Dmel_CG1721       CDS       T00030                                 

Gene name
Pglym78
Definition
Phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG1721 (Pglym78)
   01230 Biosynthesis of amino acids
    Dmel_CG1721 (Pglym78)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG1721 (Pglym78)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmel_CG1721 (Pglym78)
Enzymes [BR:dme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dmel_CG1721 (Pglym78)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dmel_CG1721 (Pglym78)
  Exosomal proteins of melanoma cells
   Dmel_CG1721 (Pglym78)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:98F12-98F13
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSV
LTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagtacaagatcgtgatggtgcgccacggcgagtccgagtggaaccagaag
aatcagttctgcggctggtacgacgccaacctcagcgaaaagggtcaggaggaggcccta
gccgccggcaaggccgtcaaggatgccggcctggagttcgatgtggcccacacctcggtg
ctgacccgcgcccaggtgacgctggccagcatcctgaaggccagtggccacaaggagatc
cccatccagaagacttggcgcctgaacgagcgccactacggtggactcactggcctgaac
aaggccgagaccgccgccaagtacggcgaggcccaggtgcagatctggcgtcgcagcttc
gacaccccgccaccaccgatggagccgggccatccgtactacgagaacatcgtcaaggat
ccccgctacgccgagggtcccaagcccgaggagttcccccagttcgagtccctcaagctg
accatcgaacgcacactgccctactggaacgacgtcatcattccccagatgaaggagggc
aagcgcatcctgatcgctgcccacggcaacagcctccgtggcatcgtcaagcatttagac
aacctttctgaggacgccatcatggccctaaatctgcccacgggcattccgttcgtctac
gagctggacgagaacttcaagccggtggtgtccatgcagttcctcggcgacgaggagacc
gtgaagaaggccatcgaggctgtggccgcccagggcaaggccaagtaa

DBGET integrated database retrieval system