KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1721Help
Entry
Dmel_CG1721       CDS       T00030                                 

Gene name
Pglym78
Definition
(RefSeq) phosphoglyceromutase, isoform C
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00010  Glycolysis / Gluconeogenesis
dme00260  Glycine, serine and threonine metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
dme01230  Biosynthesis of amino acids
Module
dme_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dme_M00002  Glycolysis, core module involving three-carbon compounds
dme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG1721 (Pglym78)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmel_CG1721 (Pglym78)
Enzymes [BR:dme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dmel_CG1721 (Pglym78)
Membrane trafficking [BR:dme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dmel_CG1721 (Pglym78)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dmel_CG1721 (Pglym78)
  Exosomal proteins of melanoma cells
   Dmel_CG1721 (Pglym78)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 43447
NCBI-ProteinID: NP_001034075
FlyBase: FBgn0014869
UniProt: Q9VAN7
Position
3R
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSV
LTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagtacaagatcgtgatggtgcgccacggcgagtccgagtggaaccagaag
aatcagttctgcggctggtacgacgccaacctcagcgaaaagggtcaggaggaggcccta
gccgccggcaaggccgtcaaggatgccggcctggagttcgatgtggcccacacctcggtg
ctgacccgcgcccaggtgacgctggccagcatcctgaaggccagtggccacaaggagatc
cccatccagaagacttggcgcctgaacgagcgccactacggtggactcactggcctgaac
aaggccgagaccgccgccaagtacggcgaggcccaggtgcagatctggcgtcgcagcttc
gacaccccgccaccaccgatggagccgggccatccgtactacgagaacatcgtcaaggat
ccccgctacgccgagggtcccaagcccgaggagttcccccagttcgagtccctcaagctg
accatcgaacgcacactgccctactggaacgacgtcatcattccccagatgaaggagggc
aagcgcatcctgatcgctgcccacggcaacagcctccgtggcatcgtcaagcatttagac
aacctttctgaggacgccatcatggccctaaatctgcccacgggcattccgttcgtctac
gagctggacgagaacttcaagccggtggtgtccatgcagttcctcggcgacgaggagacc
gtgaagaaggccatcgaggctgtggccgcccagggcaaggccaagtaa

DBGET integrated database retrieval system