KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1747Help
Entry
Dmel_CG1747       CDS       T00030                                 

Gene name
Sk1
Definition
Sphingosine kinase 1 (EC:2.7.1.107)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmel_CG1747 (Sk1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dmel_CG1747 (Sk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:10B13-10B13
AA seq 641 aa AA seqDB search
MTANTGTSGENLMGNGGKTHEPSTPTSDTEVASGTPTELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETEEDDHINEQLIRIDDIIGSRYGRRLKKRARGGLNSCRNPNVPGQEADSE
PDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAEMWHHTIRKHKRGNG
SSSPADCGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRT
RRDLLTRYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSVAHH
CNEPYEPKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLLGKGKKEPPVEAARELPAESTAAGIRSSL
PLNAGEFHDLPEEEEGEAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPS
MRSNRSRMSISQRIEAANAEFAERVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAYTTH
LSSDVFFAPESRLDDGLIYLVIIRRGVSRHQLLNFMLNLNAGTHLPIGEDPFIKVVPCRA
FRIEPSSSDGILVVDGERVEYGPIQAEVMPGLINVMTTSGQ
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacacagggacgtcgggtgaaaatctgatgggaaatggtggaaagacgcat
gaaccctccacgcccacttcggatacggaagtggccagcggcacgccaacggaactgagc
gaaatcttcttcgtggacaatagccggcgcaagcagagcatcaaaatccaggtgaaacta
tgcccggaaggcgtttacctgcgacgcgaaaccgaggaagatgatcacatcaatgagcag
ctgatcaggatcgatgatatcataggatcacgctacggacggcgtttgaagaaacgagcc
cgaggcggtctaaactcctgccgcaatccaaatgttccgggccaggaggcggattcggaa
ccggatagcgataatagcgcctatttgtacatctatgcatatttgaagaaggagaaaccg
ttgcgacgtgtccaaacgctccggattctacgctttcgttcgagcaatgactacggagtg
aatctacagaccgccgagatgtggcatcatacgattcgaaagcacaagcgtggcaatggc
agcagttcgcccgccgattgtggcaaacagttgctcatcctactgaatccgaaatccggt
tcgggcaaagggcgtgagctcttccagaaacaggtggcacctttgctgacggaagcagag
gtgcaatacgatctccagatcaccacacatccgcagtatgccaaggagttcgtgcggacc
agaagggatctgctgacacgctattcgggcattgtggttgcctccggcgatggtctattc
tacgaagtgctcaatgggctaatggaacgcatggattggcgccgagcctgcagggagcta
ccgcttggcattataccatgtggttccgggaatggtctggccaaaagtgtggcccatcat
tgcaatgaaccgtacgaaccgaagcccattctccacgccaccttgacctgcatggcgggc
aaaagtacacccatggatgtggtcagagtggagctggcgacgcgggacaagcactttgtg
atgtactccttcctgtcggtgggctggggtctgatagccgacatcgatatagagagcgag
cgattgagatcgattggagcgcaaaggtttacgctgtgggccatcaagcgattgatcggg
ctgcgcagctacaaaggccgagtgtcctatctactgggcaagggcaagaaggaaccacca
gtggaagcggctcgagagttgcctgcagaatcaacggctgcaggaatccgctcatctctg
cctctgaatgccggggaattccatgatctacccgaggaggaggagggggaggcggtcttg
gatggagaacagttcgccgatgccatatctttggatcgttcggtttaccgccagcatgcc
gacagttggcactcggccatgtccaggcgaacggcatattactccctgggcggacccagt
atgcgatccaatcgcagccggatgagcattagccagcggatcgaggcagcaaatgcggaa
ttcgctgagagggtgccaacgggcaccattccaccattacagatgccactgctcagcagc
gatggttggatctgcgaggatggtgactttgtgatggtccatgccgcctataccacccat
ctctcctccgatgtcttctttgcgcccgaatcccgtctggacgatggcctcatctacctg
gtgatcatccggagaggcgttagtcgccatcagctgctcaatttcatgctgaacctaaac
gcaggcacccatctgcccatcggcgaggatccgttcatcaaggtggtgccttgtcgggca
ttccgcatcgagccgagcagctccgatggcatcctggtggtggacggcgagcgggtggaa
tatggacccattcaggcggaggttatgcccggcctgatcaatgtgatgaccaccagtggg
cagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system