KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17610Help
Entry
Dmel_CG17610      CDS       T00030                                 

Gene name
grk
Definition
gurken
Orthology
K02447  
protein gruken precursor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG17610 (grk)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG17610 (grk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:29C4-29C4; 2L:2-30 cM
AA seq 295 aa AA seqDB search
MMQIPFTRIFKVIFVLSTIVAVTDCCSSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQ
ETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIIL
GSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQM
LPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQ
RKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaatcccatttactcggattttcaaagtaattttcgtgctctcaacaattgtc
gccgtcacagattgttgttcgagccgaatcttacttctccgagagcatacgctgaaaatt
gtgcagcatcagcacagccacatgcacgagcatgcgcacgagctgcagcagcagatccag
gagaccgcggttgagttgctcaatcgcctggagctgcagcgcaagcaactggaggcctcg
gcccaggaggaggcagaccagctgcatcccgatacggatcccaatccggactcgggcggc
caactgccaaacgcagacgactccattgctgcggatccggaacaggatgggataattctc
ggatccagtaccgacacctggttggccagcgaaagcagcacaccaatcactgattccgag
acagtgacaacacccgaaactgttacccacaccggagaaccgccacctgaccccagttcg
tccagcacgcctgactccacgactcccagcccgaacgacaaggagacagagattcagatg
ctgccctgcagcgaagcttacaatactagcttttgcctgaacggcggccactgcttccag
catccgatggtgaacaacacagtcttccattcctgcctctgcgttaacgactacgatgga
gagcggtgcgcctacaagagctggaatggtgactacatctattcgcctccaacagcgcag
cggaaggtccgaatggcgcacatcgtcttctcctttcccgtactcctcatgctgtcgtcg
ctctacgttctcttcgcagccgttttcatgctccgcaatgtgccggattatcgccggaag
cagcagcaactacacctgcataagcagcgcttttttgtcagatgctga

DBGET integrated database retrieval system