KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17632Help
Entry
Dmel_CG17632      CDS       T00030                                 

Gene name
bw
Definition
(RefSeq) brown, isoform D
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC2_membrane AAA_16 AAA_29 AAA_23 AAA_28 AAA_35 AAA_30 PRK NACHT AAA_19 AAA_18 RsgA_GTPase SMC_N DUF87 DnaB_C Zeta_toxin cobW
Motif
Other DBs
NCBI-GeneID: 37724
NCBI-ProteinID: NP_001286769
FlyBase: FBgn0000241
UniProt: P12428 A0A0B4LHB3
Position
2R
AA seq 675 aa AA seqDB search
MQESGGSSGQGGPSLCLEWKQLNYYVPDQEQSNYSFWNECRKKRELRILQDASGHMKTGD
LIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSFLPQFEINVKTF
TAYEHLYFMSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEE
LITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSFETPSGESS
ASGSGSKSIEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFEL
FTHIILMDGGRIVYQGRTEQAAKFFTDLGYELPLNCNPADFYLKTLADKEGKENAGAVLR
AKYEHETDGLYSGSWLLARSYSGDYLKHVQNFKKIRWIYQVYLLMVRFMTEDLRNIRSGL
IAFGFFMITAVTLSLMYSGIGGLTQRTVQDVGGSIFMLSNEMIFTFSYGVTYIFPAALPI
IRREVGEGTYSLSAYYVALVLSFVPVAFFKGYVFLSVIYASIYYTRGFLLYLSMGFLMSL
SAVAAVGYGVFLSSLFESDKMASECAAPFDLIFLIFGGTYMNVDTVPGLKYLSLFFYSNE
ALMYKFWIDIDNIDCPVNEDHPCIKTGVEVLQQGSYRNADYTYWLDCFSLVVVAVIFHIV
SFGLVRRYIHRSGYY
NT seq 2029 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatccggcggctcgtcgggccagggcggtccatcgctgtgcctcgagtggaag
cagctgaactactatgtgcccgcccaggagcagagcaactacagtttctggaacgagtgc
cgcaagaagcgcgagctgcggatcctccaagacgccagcgggcacatgaagaccggcgac
ctcatcgccatactgggcggatccggagcgggcaagaccacgctgctggcggcgatttcg
caacgactgcgtggtaacctgaccggggatgtggttttgaacggcatggccatggagcgg
catcagatgacgcgcatctccagctttctgccgcagttcgagatcaacgtgaagacgttt
acggcctacgagcatctgtactttatgtcccatttcaagatgcaccggcgcaccaccaag
gcggagaagcgccagagggtggcggatctcctcctggcagtgggcctgcgcgacgccgcc
cacacccgcatccagcagctgtcgggtggcgagcgaaagcgactcagcttggccgaggag
ctgatcaccgatcccatattcctgttctgcgatgaacccaccacgggcctggacagcttc
agcgcctattcggtgatcaaaacactcaggcacttgtgcaccaggcgacggattgccaaa
cattccttgaaccaggtctacggcgaggactcgtttgagacgccgagtggcgagagcagc
gccagtggcagtggcagcaagtccatcgagatggaggtcgtggccgagtcccacgagagt
ctgctgcagacgatgcgggagctcccagccctgggagtcctaagcaacagccccaacggc
acccacaagaaggcggccatctgctccatccatcagccgacgtcggacatcttcgagctc
ttcacccacatcatcctcatggatggcggcaggatcgtctaccaggggacgcaccgagca
ggcagccaagttctttacagacctgggctacgaactcccgctgaactgcaatcctgcgga
cttctacctgaagaccctggcggacaaggagggcaaagagaacgcgggggctgtgctccg
ggcgaagtacgagcacgagacggatggactctacagcgggagctggctgctggcgcggag
ctacagcggggattacctgaagcacgtccagaacttcaagaaaataaggtggatatatca
ggtgtacctcctgatggtgcgcttcatgaccgaggatgtgcggaatattaggagtgggct
catcgcctttggcttcttcatgatcaccgctgtaacactatccctcatgtactccggcat
tggaggactcacgcaacggacggtgcaggacgtcggtggatccatcttcatgctcagcaa
cgagatgatcttcacgttcagctatggcgtgacgtatatatttcccgccgcccttcccat
catcaggcgggaggtgggcgagggcacctacagcctgtccgcctactacgtggccctggt
gctctccttcgtgcccgtggccttcttcaagggctacgtcttcctgtcggtgatatatgc
ctccatatactacacgcgcggcttccttttgtacctcagcatgggcttcctgatgagcct
gtccgcggtggcggctgttggctatggggtcttcctctccagcctcttcgagtcggataa
gatggcctccgagtgcgcggcgcccttcgatctgatcttccttatctttggcggcaccta
catgaatgtggacacagtgcctggactaaagtacctctcgttgttcttctactccaacga
ggcgctgatgtacaagttctggatcgacatcgataatatcgactgccccgtcaacgagga
tcatccgtgcatcaagaccggagtggaggtgctgcagcagggatcctatcgcaccgccga
ctacacctattggctggactgcttcagtctggtggtggtggccgtcatctttcacatcgt
gtcctttgggctggttaggcgatacattcaccgcagtggttactattga

DBGET integrated database retrieval system