KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17632Help
Entry
Dmel_CG17632      CDS       T00030                                 

Gene name
bw
Definition
brown (EC:3.6.1.3)
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:59E2-59E3; 2R:2-104.5 cM
AA seq 675 aa AA seqDB search
MQESGGSSGQGGPSLCLEWKQLNYYVPDQEQSNYSFWNECRKKRELRILQDASGHMKTGD
LIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSFLPQFEINVKTF
TAYEHLYFMSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEE
LITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSFETPSGESS
ASGSGSKSIEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFEL
FTHIILMDGGRIVYQGRTEQAAKFFTDLGYELPLNCNPADFYLKTLADKEGKENAGAVLR
AKYEHETDGLYSGSWLLARSYSGDYLKHVQNFKKIRWIYQVYLLMVRFMTEDLRNIRSGL
IAFGFFMITAVTLSLMYSGIGGLTQRTVQDVGGSIFMLSNEMIFTFSYGVTYIFPAALPI
IRREVGEGTYSLSAYYVALVLSFVPVAFFKGYVFLSVIYASIYYTRGFLLYLSMGFLMSL
SAVAAVGYGVFLSSLFESDKMASECAAPFDLIFLIFGGTYMNVDTVPGLKYLSLFFYSNE
ALMYKFWIDIDNIDCPVNEDHPCIKTGVEVLQQGSYRNADYTYWLDCFSLVVVAVIFHIV
SFGLVRRYIHRSGYY
NT seq 2029 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatccggcggctcgtcgggccagggcggtccatcgctgtgcctcgagtggaag
cagctgaactactatgtgcccgcccaggagcagagcaactacagtttctggaacgagtgc
cgcaagaagcgcgagctgcggatcctccaagacgccagcgggcacatgaagaccggcgac
ctcatcgccatactgggcggatccggagcgggcaagaccacgctgctggcggcgatttcg
caacgactgcgtggtaacctgaccggggatgtggttttgaacggcatggccatggagcgg
catcagatgacgcgcatctccagctttctgccgcagttcgagatcaacgtgaagacgttt
acggcctacgagcatctgtactttatgtcccatttcaagatgcaccggcgcaccaccaag
gcggagaagcgccagagggtggcggatctcctcctggcagtgggcctgcgcgacgccgcc
cacacccgcatccagcagctgtcgggtggcgagcgaaagcgactcagcttggccgaggag
ctgatcaccgatcccatattcctgttctgcgatgaacccaccacgggcctggacagcttc
agcgcctattcggtgatcaaaacactcaggcacttgtgcaccaggcgacggattgccaaa
cattccttgaaccaggtctacggcgaggactcgtttgagacgccgagtggcgagagcagc
gccagtggcagtggcagcaagtccatcgagatggaggtcgtggccgagtcccacgagagt
ctgctgcagacgatgcgggagctcccagccctgggagtcctaagcaacagccccaacggc
acccacaagaaggcggccatctgctccatccatcagccgacgtcggacatcttcgagctc
ttcacccacatcatcctcatggatggcggcaggatcgtctaccaggggacgcaccgagca
ggcagccaagttctttacagacctgggctacgaactcccgctgaactgcaatcctgcgga
cttctacctgaagaccctggcggacaaggagggcaaagagaacgcgggggctgtgctccg
ggcgaagtacgagcacgagacggatggactctacagcgggagctggctgctggcgcggag
ctacagcggggattacctgaagcacgtccagaacttcaagaaaataaggtggatatatca
ggtgtacctcctgatggtgcgcttcatgaccgaggatgtgcggaatattaggagtgggct
catcgcctttggcttcttcatgatcaccgctgtaacactatccctcatgtactccggcat
tggaggactcacgcaacggacggtgcaggacgtcggtggatccatcttcatgctcagcaa
cgagatgatcttcacgttcagctatggcgtgacgtatatatttcccgccgcccttcccat
catcaggcgggaggtgggcgagggcacctacagcctgtccgcctactacgtggccctggt
gctctccttcgtgcccgtggccttcttcaagggctacgtcttcctgtcggtgatatatgc
ctccatatactacacgcgcggcttccttttgtacctcagcatgggcttcctgatgagcct
gtccgcggtggcggctgttggctatggggtcttcctctccagcctcttcgagtcggataa
gatggcctccgagtgcgcggcgcccttcgatctgatcttccttatctttggcggcaccta
catgaatgtggacacagtgcctggactaaagtacctctcgttgttcttctactccaacga
ggcgctgatgtacaagttctggatcgacatcgataatatcgactgccccgtcaacgagga
tcatccgtgcatcaagaccggagtggaggtgctgcagcagggatcctatcgcaccgccga
ctacacctattggctggactgcttcagtctggtggtggtggccgtcatctttcacatcgt
gtcctttgggctggttaggcgatacattcaccgcagtggttactattga

DBGET integrated database retrieval system