KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17645Help
Entry
Dmel_CG17645      CDS       T00030                                 

Definition
(RefSeq) Pglym87
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG17645
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmel_CG17645
Enzymes [BR:dme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dmel_CG17645
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dmel_CG17645
  Exosomal proteins of melanoma cells
   Dmel_CG17645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 292 aa AA seqDB search
MLALARNSWCGQLLCRVANIEARCPFSKSSSGGKQAEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETLRAALKSSEHKKIPVC
TTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctggccaggaattcgtggtgtggccaattgctgtgtcgcgtggcgaacatc
gaagcccgctgcccgttctcgaagtcatcatccggcggaaagcaggccgagaagaagggc
aagtacaggattgtgatggttcgtcatggagagtccgaatggaatcagaagaacctattc
tgcggatggttcgatgccaagctatcggagaaggggcagcaggaggcctgtgccgctggc
aaagcgctcaaagatgccaaaattgagttcgatgtggcccacacctcggtgctgaccaga
gcccaggagacactcagggccgccctaaagtccagcgagcacaagaagattccggtgtgc
accacgtggcgcctcaacgagcgccactacggcggactgacgggactgaataaggccgag
accgccaagaagttcggcgaggagaaggttaagatctggcgccgcagctttgacacccca
ccgccgccaatggagaaggatcacgagtactacgcctgcattgttgaggatccgcgctac
aaggaccaactgaagccggaggagttccccaaatccgagtccctcaagctcaccatcgag
cgcaccttgccctactggaacgaggtcatagtgccccagatcaaggatggaatgcgtgtc
ctgatcgccgcccacggcaacagcctgcggggcgtggtcaagcacttggaatgcatctct
gacaaggacattatgagcctcaacctgcccactggcattcctttcgtctacgaactagac
gagagcctcaagcctttggccacgttgaagttcctcggcgatccggagacggtgaagaag
gcaatggagtcggtggccaaccagggcaaagccaagtga

DBGET integrated database retrieval system