KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17645Help
Entry
Dmel_CG17645      CDS       T00030                                 

Gene name
Pglym87
Definition
CG17645 gene product from transcript CG17645-RA (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dme01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dme01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dme00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dme00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:87B3-87B3
AA seq 292 aa AA seqDB search
MLALARNSWCGQLLCRVANIEARCPFSKSSSGGKQAEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETLRAALKSSEHKKIPVC
TTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctggccaggaattcgtggtgtggccaattgctgtgtcgcgtggcgaacatc
gaagcccgctgcccgttctcgaagtcatcatccggcggaaagcaggccgagaagaagggc
aagtacaggattgtgatggttcgtcatggagagtccgaatggaatcagaagaacctattc
tgcggatggttcgatgccaagctatcggagaaggggcagcaggaggcctgtgccgctggc
aaagcgctcaaagatgccaaaattgagttcgatgtggcccacacctcggtgctgaccaga
gcccaggagacactcagggccgccctaaagtccagcgagcacaagaagattccggtgtgc
accacgtggcgcctcaacgagcgccactacggcggactgacgggactgaataaggccgag
accgccaagaagttcggcgaggagaaggttaagatctggcgccgcagctttgacacccca
ccgccgccaatggagaaggatcacgagtactacgcctgcattgttgaggatccgcgctac
aaggaccaactgaagccggaggagttccccaaatccgagtccctcaagctcaccatcgag
cgcaccttgccctactggaacgaggtcatagtgccccagatcaaggatggaatgcgtgtc
ctgatcgccgcccacggcaacagcctgcggggcgtggtcaagcacttggaatgcatctct
gacaaggacattatgagcctcaacctgcccactggcattcctttcgtctacgaactagac
gagagcctcaagcctttggccacgttgaagttcctcggcgatccggagacggtgaagaag
gcaatggagtcggtggccaaccagggcaaagccaagtga

DBGET integrated database retrieval system