KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17903Help
Entry
Dmel_CG17903      CDS       T00030                                 

Gene name
Cyt-c-p
Definition
Cytochrome c proximal
Orthology
K08738  
cytochrome c
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dmel_CG17903 (Cyt-c-p)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:36A11-36A12
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcctgctggtgatgttgagaagggaaagaagctgttcgtgcagcgctgcgcc
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctgcatggtctg
atcggtcgcaagaccggacaggcggccggattcgcgtacacggacgccaacaaggccaag
ggcatcacctggaacgaggacaccctgttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaacgagcgcggcgatctgatc
gcctacctgaagtcggcgaccaagtaa

DBGET integrated database retrieval system