KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17907Help
Entry
Dmel_CG17907      CDS       T00030                                 

Gene name
Ace
Definition
Acetylcholine esterase (EC:3.1.1.7 3.1.1.8)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmel_CG17907 (Ace)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dmel_CG17907 (Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3R:87E2-87E3; 3R:3-52.5 cM
AA seq 649 aa AA seqDB search
MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSGPVRGRSVTVQ
GREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEI
WNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLP
ILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEA
PGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQWN
SYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDK
DDATALPRDKYLEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTC
PTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVE
RELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccatctcctgtcggcagagcagagtcctgcccatgtccttgcccctgcctctgacc
atcccgctgcccctggtgctggtgctatcactgcacctgtccggcgtctgcggcgtcatc
gatcgcctggtcgtgcagacatcctccggacctgtacgcggtcgctccgtgacggtgcag
ggcagggaggtgcatgtctacacgggcatcccctacgccaagccgcccgtcgaggacctg
cgcttccgaaagccggttcccgcggagccatggcacggcgtcctcgacgccacgcggtta
tccgccacctgcgtccaagagcgttacgagtacttccccggcttctccggcgaggagatc
tggaaccccaacaccaacgtgtccgaggactgcctctacataaatgtctgggcgccggca
aaggcccgacttcgccatgggcggggtgccaacgggggtgagcaccccaatggcaaacag
gcggacactgaccatctcatccacaacggaaatccgcagaacacgaccaacggactgccg
attctgatctggatctatggcggtggcttcatgaccggatcggccaccctggacatctac
aatgcggatatcatggccgccgtgggcaatgtaatagtggcctccttccagtatcgggtg
ggagcctttgggttcttgcacctggcgccggaaatgccgtcggaattcgcggaagaggcg
cccggcaatgtgggcctatgggatcaggcactcgccattcgctggctgaaggacaacgct
catgccttcggcggaaatccggagtggatgacactgttcggagagtcggctggatccagt
tcggtgaatgcccagctcatgtcgccggtgacgaggggtctggtcaagcgcggaatgatg
cagtcgggcactatgaacgccccctggagccacatgacctccgagaaggccgtggagatc
ggcaaggcgctgatcaacgactgcaactgcaatgcatctatgctgaagaccaatcccgct
cacgtgatgagctgcatgcgttccgtggacgccaagaccatatcggtgcagcagtggaac
tcctactcgggcatcctcagctttccctcggcgcccaccattgatggtgcgttcctgccg
gcggatcccatgacgctgatgaagacggcggatctgaaggactacgacatcctgatggga
aatgtcagggatgagggcacttacttcttgctgtacgatttcatcgattacttcgataag
gacgatgccacggccctgccacgggacaaatacctggaaattatgaacaatatttttggc
aaggcaacgcaagcggaacgcgaggccatcattttccagtataccagttgggaaggcaat
cctggctatcagaaccagcagcaaatcggacgcgccgtgggcgatcacttcttcacctgc
cccaccaacgagtatgcccaggctctggcggagcgaggcgcttccgtgcactactactac
tttacacaccgcacaagcacctcattgtggggcgaatggatgggcgtgctgcacggcgat
gagatcgaatacttctttggccagccgctgaacaactccctgcagtatcgacctgtggag
cgtgagctgggcaagcgtatgctcagtgcggtcatcgagtttgctaagacgggaaatccc
gctcaggatggcgaggagtggcccaacttctccaaggaggatcccgtctactatattttc
agcaccgacgataagatcgagaaattggccaggggtcctttggcggctcgctgctcgttc
tggaatgattacttgccaaaagtcaggagttgggcaggtacttgcgatggcgattcggga
agtgcttccatatccccgaggctccagctccttggaatcgctgctctgatctacatctgc
gccgcattgcgaaccaaaagggttttctaa

DBGET integrated database retrieval system