KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18104Help
Entry
Dmel_CG18104      CDS       T00030                                 

Gene name
arg
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dmel_CG18104 (arg)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dmel_CG18104 (arg)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dmel_CG18104 (arg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:1B7-1B8
AA seq 229 aa AA seqDB search
MWWSRKFASRSLRLHRLKSTGSTAPREPEQSLGIIGVPFAKGQAKQGVELAPDLLRQSSL
RQVLQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLV
ENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EQLRNTWQHAGLQEIAPNCSVIPRLDPTTICLRVSCLRPIRSSNNSCSV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgcctcaaggtctctccgcctccaccggctcaagagcacc
ggaagcactgcgcccagggaacctgagcaatctctaggcatcattggagtgcccttcgca
aaggggcaggccaagcagggcgtggaactggcgccagatcttctccggcagagcagtctg
cgtcaggtgcttcagagcagtcatgatggcctggtgatacgggactacggaaatctgcag
tacgccgtagacgagccccttctccagcagcagcgtgtgcactatcaccacatccgaaac
tacgcggacttcatggcctgcaatcgggcactgattgaacaggtgaaactcatgctcgtg
gagaacacgcagtttttagccattggtggtgatcatgcgatcggcttcggatccgtggcc
gggcacctgcaacacacgccgaatttgtccctggtgtggatcgacgcacatgcggacatc
aatctgcatagcacctcgcagtcgggcaacatccatgggatgcctgtatcctttctgttg
gaacagctccgtaacacctggcagcacgctggcctccaggaaatcgcgcccaactgttca
gtgatccctcgactggatcccacgactatttgcttacgtgtcagctgcttgcggcccatc
cgatcctccaacaattcctgttctgtatag

DBGET integrated database retrieval system