KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18179Help
Entry
Dmel_CG18179      CDS       T00030                                 

Definition
CG18179 gene product from transcript CG18179-RA (EC:3.4.21.-)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:67C3-67C3
AA seq 268 aa AA seqDB search
MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIR
TDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPN
WPAEGGRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWL
QCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGS
VDCHSGPSGYTRVTDYLGWIRDNTGISY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcctacttacactctccgtggccctagccgtggtcgccgcctccccaggc
ttcaaccgcaccagccttctgccccaggtgaccatttccgagggtgccgagggccgcatc
gtcaacggttacccagcgcccgagggaaaggctccctacattgtgggactgttgatccgc
accgatggaagcaacagtgccgcggttggagctggaaccatcatcgccagcgactggatt
ctgaccgccgctcactgtctgaccaccgactacgtggagatccactatggatccaactgg
ggctggaacggagctttcaggcaatctgtccgccgtgacaactttatcagccatccaaac
tggcccgctgagggcggtcgtgacatcggtctgatccgcactccctccgtgggcttcacc
gacttgatcaacaaggtcgccctgccaagcttcagcgaggagagcgaccgcttcgtggac
acatggtgcgttgcctgcggatggggcggcatggacaatggcaacctggccgactggctg
cagtgcatggacgtccagatcatcagcaacagcgagtgcgagcagtcctacggcaccgtg
gccagcactgacatgtgcacgcgccgcaccgatggcaaatcctcttgcggaggcgactct
ggtggtccactcgttacccatgacaacgctcggctagtgggagtgattacctttggctcg
gtggactgccacagcggtccttccggctacacccgcgtcaccgactacttgggatggatc
cgtgacaacaccggcatctcctactaa

DBGET integrated database retrieval system