KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18374Help
Entry
Dmel_CG18374      CDS       T00030                                 

Gene name
Gyk
Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dme00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61B2-61B2
AA seq 538 aa AA seqDB search
MDSPTTETTPPPPTLSGPFVGAIDEGTTSARFIIFRAGTDEIVCFHQIEVESIFQKEGWC
EQDPMAIVNTVNECITGACKKLVAVGGKVEEIITIGITNQRESTVVWDRNSGQPLVNAII
WLDNRTTSTVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAMEK
GTAMFGTIDTWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPKTIL
PEICSSSEFYGSIAQGVLQGIGITSVLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTG
PSIVHSTHGLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMAS
TVDNSLDVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDS
MHKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENR
YQMEAPLSKSGPREAIKPSISATDRNLRYQKWKMAIDRSLNWETSTLPQGEREAFDGA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggattctcccacaaccgaaacgacaccgcctccacccacgctatctggtccattcgtt
ggggctattgacgagggaaccacttccgcgcgatttattatatttcgtgcgggcactgac
gaaattgtgtgctttcatcagattgaagtggagtctattttccagaaggagggatggtgc
gagcaggatcccatggccatagtgaatacggtcaacgagtgcatcaccggtgcctgcaag
aaacttgtggccgtgggcgggaaggttgaggaaataatcacgattggaataacaaaccaa
cgcgagtccacagtcgtatgggatagaaactccggccaaccgctggtgaacgctatcatc
tggctagacaatcgtaccaccagcacggtggaggagcttttggagactattccgaacaat
gccaggaacatcaactacctgcgcccattgtgcggacttcctctgtctccgtacttttcg
ggcgtgaaactacgctggcttcgagacaacgtgccggttgtcagccaggctatggagaag
ggcacggccatgtttggcaccatcgacacctggctaatgtataatcttacgggcgggaag
gactgtggtgtccacaagacggatgtgaccaacgcttcgcgcactatgctcatgaacatc
gagacccttcagtgggatgccaacttgctaaagttctttgggctgcccaagaccattttg
ccggagatctgctcgagctcagagttctatggcagcattgcgcagggcgttctgcaaggc
ataggcataacatcggttctgggcgaccagcaagccgctctagtgggtcaacaatgcctg
gccaaaggtcaggccaaagccacttatggcactggatgttttctgctttataacacagga
ccttcaattgtacactcaacgcacggattactaacgactgttggctaccaactaggacgg
aaggcagtcccattttacgcccttgagggaagcgtgtccattgccggtgcagcattcaac
tggctgcgcgacaacatgaaccttattcaaaactcggggcagatcgaaaccatggctagc
actgtggacaactctcttgacgtatacttcgtaccagctttcaatggactctacgccccc
tactggaatcaggacgctcgcggtgtcatttgtggactgagtgaagaaacaacaagtgag
cacatagtaagagccaccctggaagcagtttgtttccaggtccgtgatattctcgattcg
atgcacaaggactgcaagattccactggccaagcttatggtagacgggggcatgactgtg
aataatctgttcctgcagcttcaatccgacctagtaggaattcaagtactccgggcgaag
atcgcagagacaacagcgctgggagctgcaatggcagcctacaaagccgttgaaaaccga
taccaaatggaggctccactctctaaatctggcccccgagaagccataaagccatcgatc
agtgccaccgatcgcaacctgcgctaccaaaagtggaaaatggctatcgatcgttcactg
aactgggagacttcgacgcttccacagggcgaacgggaggcctttgacggagcgtga

DBGET integrated database retrieval system