KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1842Help
Entry
Dmel_CG1842       CDS       T00030                                 

Gene name
Dhc98D
Definition
Dynein heavy chain at 89D (EC:3.6.1.3)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG1842 (Dhc98D)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     Dmel_CG1842 (Dhc98D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:98D2-98D3
AA seq 5073 aa AA seqDB search
MSQTQFESTSDSADATAESLNNVEPRIVWLKTIMSNMLGVFEPKYVNATISKNMPAVENF
FQRRYETQNDLDFVVLFFWRTFYDKLIEEEITVLEEVPRPPPTVPDKKGKGKKKGDARMA
GGKSAGKAGASAGAAGKGRKKAGQDAAAPAGGDQEAVEEVNTGGETTDAEVEGELEGEEE
ATVAGSGKSSARSRRSKFRKKKATYVPVYVEVKKLVPAYVKTPQVHCHFGRMESCDLDPK
IKYIYIVRKNRREIPNFSDVSACFAQMPLYFLLGTVRGSLINSLRDDLNLVYKSAIQFQF
REPATADSQQMDSYEGQAGGSGGGGAGGPAGETGEDISSEAKESGPGLLELSKPSEFRLR
ALKQQKKMKEKEAAAKKAKAKKTDAEPTEEEEEADAHKVEAHLSSSEEEVEIKVEKLTIG
QRWEKMLNETKAKVEAEHAAEEATPPRITPIQRRLLKEIEEFQSEITWTINHIVWAFSLP
SSYILPGQEATEFEDAIIRVPVDPKRLDLVITYTQQQLEEVVDGWIKYLKKTMKTLTDAK
LDDFTPMAEHRYWHKMEVELYGTLEQLKTEFVVAVLQRLTDDKSPVLDEWQAVVEKTEAR
FKLAKENSDYLGTIIDYLEKVRSYESFKMVVLQIPNIMVGLRHIWTMSSHYCRDPEMQVL
LCQISNVFVQKVKSIINFENIFKYSATYTYETATNCANLLRCWKQAYKLSRQHIEDSGAG
SRWEFDRVALFNEVNHIHRVAVDIAYVGRVFVQYENLFGHRLKACIADPSIVDNLMRKVY
RMLDDLIKSVDYDMFRPGNWENWEYSLELFNKRLDNVENEAKNVIDQSINSLLSSEKGLD
LVVNAMNIDTRATLQEFVATKHENLLRFFVTEINAVERVFTKLKKSPPMAKHQPAKISAI
FWARLLGKKLKTSVLAFKRVEDEPAIKNSFLKRSSFKQYFELMTVMFQFEKVLFENFIQN
ATYLVNTTNRSNVLRIRICKESTMSYISEAVQTLKAKPRPELQMTSDRRVTPVKSSNLMP
VQSEAFSAYSVADSAGTEISSESENEGLLVGDTSQKKLMCRINRLTVLVAMIMWMVSNTR
KANIQLQECTAFIKMVKDKKPKDVTAMDRHCVRTCELLQRAESQYLLPIWRELVGEKTLI
EYDMDFVVNLKRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYR
SIINNLSMSEVIFLRGHIYDTELFIQMGVGRYTWTSFNIGKFCDQINSQLRKLTSIVSQI
NFIRLDLRSRIDMIKSFNLFNLDDELKVEDTSRSSGESYLQDRKNPSQRFKSVTGETITM
FSVEKDVPADEKAEQACGSGIYPCQGYFELLEASRNRKAAQMKKLYDSLGPVLVKLESLV
LGTFSGRSDRMKTYYEYWEGETFKCIVDMTYQNLKCYINRLLSNKPMFEVNAVLLMSEIV
LEPSVQELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEMGKQFKYNYTYYEDVIQIR
SIVDLVINIHDLASRVANEARGFVSQFRKYFNLWAFEKSFICQKFLEKQVTLIEIDEKFT
FYSSIVETLANTRKFQDIKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRN
EVKTLSLNLNKTTRELEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYE
DMLMAHHLEKRWKRLFLSALYRYEKLQPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGP
GSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQ
LYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEIHMK
QFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQI
LTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQ
SMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEAR
KFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIF
PRFYFISTDELLSILGSSEPSAVQNHIIKMYDNIKSLRLVKEGSQTIVTGMISSEGEVME
FRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQISRPDWLMNYQGMVGLAA
SQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCT
VDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNG
RLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMD
YRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDRFVFEGVEIH
LDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAK
KMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPK
FVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQEDKVVQMYETM
MTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKCLVLNPKACSVIELYGFLDMETRDW
IDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLEN
YCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEPQRELLNDFFEKI
ITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQ
NYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQS
KPTLYDYFWDVKDNVWKAWEWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRP
VLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYG
PPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAA
MGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMI
VHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEY
TRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKA
DIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSV
YFLFTEILEEYCERKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRL
AAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELIN
NILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSP
AGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFLTEHRLIPASHREAIVEHVVH
VHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIE
EASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGK
QIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKG
YKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNLEDMAKISVAGAGL
LRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYA
TSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISAS
FLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDE
LSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGT
PVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDP
AVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLL
RELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAV
LFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCT
GIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDV
LKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFR
VDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLAD
TIVGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENP
HPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFR
PLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGKIPWNSLK
YLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCLPEEETILK
EDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGEGTGGISRDDF
IDSVAAGILKKLPPAFETWRIRKQIQMSLSPTGVVLLQELDRFNLLVVRIKKTLELLRKA
IAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGE
PLVMWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVH
GLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNA
MGVGLVFEANLATSEDLSHWILQGVCLTLNTDT
NT seq 15222 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaacgcaatttgaatccacctcagacagtgccgatgccacggcagagtccctt
aacaacgttgaaccccgtatcgtctggctgaagacgattatgtccaatatgctgggagtt
tttgaacccaagtatgtgaatgcaacgatcagcaaaaatatgcctgccgtggagaatttt
ttccagcgacgttacgagacccaaaacgatttggatttcgtggtgttgttcttctggcgc
accttctacgacaaactcatcgaggaggagattaccgtgctggaggaggtgccgcgccca
ccacccacagttcccgacaaaaaaggcaagggcaaaaagaagggcgatgcccggatggcg
ggcggaaagtccgccggcaaagcaggtgcatcggcaggagcagccggaaagggacgcaag
aaagctggccaggatgcagcggcaccagccggtggtgatcaagaggccgtcgaagaggtc
aacactggtggtgaaaccacagatgccgaggtagaaggcgagttggagggcgaggaggag
gcaaccgtggctgggagtggcaagagctcagctcgatccagacgaagcaaatttaggaag
aagaaagccacttatgtacccgtctacgtggaagtgaagaaacttgtcccggcgtacgtg
aaaaccccacaagtgcactgccattttggaaggatggagtcctgtgacttggatccgaag
attaagtacatatacatcgtgcgaaaaaaccggagggagataccaaacttcagtgacgta
tcggcctgctttgcccaaatgcccctttactttctgctaggcaccgttcgagggtcactc
atcaactcgctgagggatgacttgaacctggtttacaagagcgccattcaatttcaattt
cgcgaaccggccacagcggatagccagcaaatggacagttatgaggggcaggccggcgga
tctgggggcggaggagcgggcggccctgcaggagagaccggcgaggatatatccagcgag
gccaaggaatcgggcccgggtctattggagctatccaaaccatcggaatttcgtttgaga
gcgcttaaacaacaaaagaaaatgaaggagaaggaggcggcggccaaaaaggcgaaggcc
aagaaaacggacgctgagcccacggaggaggaagaagaagctgacgcccacaaagttgaa
gcccatttgtcgtcctccgaagaggaagtggagataaaagtcgaaaagctgacgattggt
caacgatgggaaaagatgctcaatgagacgaaggccaaagtagaggcggaacacgctgcc
gaagaagccacgccgccacgcatcacgcccatccagaggcggctactcaaggagatcgag
gagttccagagtgaaataacgtggaccatcaatcacattgtatgggcctttagtctgccg
tcgtcgtacattctgcccggtcaggaggcaaccgaattcgaggacgccatcattagggtg
cctgtcgatccaaaaagactggacctggtgataacatacacccagcagcagctggaagaa
gtggtcgacggttggatcaagtacctcaagaagacaatgaagacgcttacggatgccaaa
ttagacgattttactccaatggccgagcaccgctactggcacaaaatggaggtggaactc
tacggaactttggagcagttaaagaccgagtttgtggtagctgttctacagcgtctgact
gatgataaatccccagtacttgatgagtggcaagctgttgtcgaaaagactgaggctcgc
ttcaagttggccaaggaaaactctgactacttaggtaccatcatagattacctggagaaa
gtacgaagctatgagagctttaagatggtggtgctccagatccccaacatcatggttggg
ctacgccacatctggaccatgtccagccactattgccgtgatcccgagatgcaggtcctg
ctctgccagatctcgaatgtgttcgtccagaaggtgaagagcatcatcaactttgagaac
atattcaagtactcagcgacctacacctacgagacggccaccaactgtgccaacttgctg
cgctgctggaaacaggcctacaagctcagtcgccagcacatcgaggattccggggctgga
tcccgctgggaattcgacagagtggcgctcttcaacgaggtgaaccacatccatcgcgtc
gccgtggacattgcctatgtgggtcgcgtgttcgtccagtatgagaatctgtttggacac
cgcttgaaagcctgcattgcggatccctcgattgtggacaacctgatgcgcaaggtctat
cgcatgcttgacgatctgatcaagagcgtcgactatgacatgttcagaccgggaaactgg
gagaactgggagtactcgctggagttgttcaacaagcggctggataatgtggagaatgag
gccaagaacgtgatcgaccaaagcatcaactccctgctgtcctctgagaagggtcttgac
ttggtggtcaatgctatgaacatagacaccagagccactctacaggagtttgtggccacc
aaacatgagaacctactgcgattctttgtgaccgagataaacgcagttgagcgcgtattc
acgaaattaaaaaaatcccctcccatggccaagcaccagccggccaaaataagtgccatc
ttctgggcccgcttgctaggtaaaaagctcaagacctcggtgctggcattcaagagggtg
gaggatgaaccggctatcaagaacagcttcctaaagcgcagctcttttaagcagtacttc
gagttaatgactgtgatgttccagtttgaaaaggtgctcttcgagaacttcatacagaac
gccacgtacttggtgaacaccacaaaccgatccaatgtgttgcgtattcgcatatgcaag
gaatctacaatgtcctatatttccgaagccgtgcagaccttgaaggccaagccccgacct
gaattgcaaatgaccagtgataggcgggttactcccgtaaagtcttcaaatcttatgccc
gtgcaatcggaagcgtttagtgcctacagcgtcgcggattcggcaggaacggaaatcagc
tcggaatcggagaacgagggcttgctagtgggtgacacatcacaaaagaaactgatgtgc
cgcatcaaccgactgaccgtgctggtggccatgatcatgtggatggtcagtaacacacga
aaggcaaatatacaacttcaggaatgcacagcgtttattaaaatggtcaaggataagaag
cccaaagatgttacggcaatggataggcactgtgttaggacttgcgaattacttcaacga
gcagagtcccaatatctgctgcccatttggcgtgaactcgttggggagaaaacacttatc
gaatatgacatggattttgtcgtcaatctgaagcgcgatgtcttcgatgtcctgtttgaa
gctcagcagtttgagcatcttggctttacacttcccgcagtcttgcgtactgcgattatg
aaaaaggacctgctcttcaaggattatgaaaggatgaccgaggtcgttgacaggtatagg
tcaattatcaacaacctgtccatgtcagaggtgatcttcctacgcggccacatctacgac
actgaactctttatccaaatgggcgtgggtcgatacacttggacttcgttcaatataggc
aaattctgtgatcaaatcaattcacagctgcgcaaactgacctctatagtatcccaaatc
aattttattcgcctggatctgcgctctcgtatcgatatgattaagagtttcaatttgttc
aaccttgatgatgaacttaaagttgaggatacatctagatcctctggcgaatcgtatcta
caagataggaagaacccgtcccaaagattcaaatcggtcactggggaaactataacgatg
ttttcggtcgaaaaagacgttccggcggatgaaaaggcagagcaagcctgtggatccggc
atatatccatgtcagggatatttcgaactcttagaggcatcgcgcaatcgaaaggcagcc
caaatgaagaagctttacgactccctgggcccggtattagtcaagctggagagcttggtg
ttgggcacattttctggaaggtcggaccggatgaaaacctactacgagtattgggaagga
gagacattcaagtgtattgttgacatgacgtatcagaatttaaaatgctatatcaaccgc
ctgctctcaaataaaccgatgtttgaggtgaacgctgttctcctgatgtcagaaatcgtc
cttgagccttcggttcaggagctgcagaacaccattgtgactgccactaaggactatata
tccaggttgagaattttcacccgttggatgaccggaacctgcatagcctgtccactggtg
gaaatgggcaaacagttcaagtacaattacacgtactatgaggacgtaatccagataaga
tccattgtggatctggtcataaacatacacgatttggcttctagagtggcgaacgaagcc
aggggatttgtgtcgcaattccgaaagtacttcaatctgtgggccttcgagaagagtttc
atctgccagaagttcttggaaaaacaggtgacgctcatcgaaatcgatgagaaatttaca
ttttactcgtccattgtggaaacactggccaacacccgcaagttccaggacatcaagtgt
gtgcgcataaatttggagcccttgctggcgagcataacgcaacatgcccaggactggtgc
accacactgggcgaggagctgttgcgccatgtcaacgataacatgagggcaatgcgtaac
gaagtcaaaacccttagcctgaatctgaacaagaccacacgcgagctggaggacttcaag
ctggtcatgaccacgattggcacggtgcagtcgtcgacgttgaccaacgagcagaaaatc
cacgaaatgcaggagaccttcaccattcttagcgaacacaaaattatgttcccctacgag
gacatgctgatggcccatcacctggagaagcgctggaagaggctcttcctatcggccctg
tatcgctacgagaagctacaaccaattaagcagaaattcgccgacatgacttccgtcgaa
atcgatgagttctgcgatgatttggccgagtttatcaaggattacgacgagaacggaccc
ggctccgtgggcgccgaactggagcgaggagtgcgcctaatggatccgtatggccagaaa
atagccgaacgcgaatcgagacgcgaggagctggccaatgcagagcgactgttcgacatg
gccatggttgattaccatgagtttgcgcgggtgcaaaccgagtttgagggactgcagcag
ctgtacaaactatacaaggcgcagaaatacgctcgcgaaggatggggcaagaccttgtgg
gccgatctggatcccaatgtactgaccgagggcgtcgagagctatctgaaggagttccgg
aaatttaccaaggcggtgcgcaccctgcccgttggcgtccagctggagatccacatgaag
cagttcaagggcaccgtgccgctcatggttagcctcaaacacgaggctctcagggagcgc
cactggctgcagttgatggagaagacgggtcagtacttcgacatgtcaccggcccgattc
acgctggagaacatgttcgcaatgcagctgcacaagtaccaggagatcgccgagcagatc
ctaaccaatgccatcaaggagttgcaaatcgaacggggtgtccaggctgtcatcgagacc
tgggcctcgatggccttcaagaccttcaagcacttcaagggatcagatgatcggggttgg
gtgctgggtccggtggacgagatcatgcagatactcgaggataatgccatgaatctccag
tcgatgggagccagtcagtttattggaccctttctggagacggtgaacaaatgggagcgt
accttggccctcatctcggagatcatcgacgagtggttggtagtgcagcgcaagtggctc
tatctggagggcatattcattggcggcgacattcgtacccagctgccggaggaggcgcgg
aaattcgatgacattgacaagtcgtatcgcaggatcatggtcgattgtgccaaaaatccg
ttagtggtgccattctgcacagtacccggtcgcttagtggaaatacagggcctgggcatt
ggcttggaaaattgtcagaagtcgttaaacgaatatttggactcgaagcgtcgcattttt
ccgcgtttctatttcatatccaccgatgagctgctctccatcctgggcagcagtgagcca
tctgcagtgcagaaccacatcattaagatgtacgacaatatcaagtcgttgcgcttggtc
aaggagggcagccagacgattgttaccggcatgatttccagcgagggcgaggtcatggag
ttccggcactctgcacgggcagcgggacgcgtggagtactggatgaacgatgtcctggac
gaaatgcgccgctccaaccgcttcataaacaagacggccatctacgactttggcacagat
ctgcaaatttcaaggcccgactggctaatgaactaccagggaatggttgggctggctgcg
agtcaagtctggtggacggcagaggtggaggaggccttcgaccaggcccaaaatcatggc
aacatgcgggccatgaaggatttccttggcaaaaacaactatcagatcgaggagctggtc
cttaaggtgcgctccaatctctcccgcaacgatcgactcaagttcaaggcccagtgcaca
gtggatgtccatgcaagggatattattgacaactttgtgcgagacaatgtcctggatgcc
agcgaattcagctgggaaagtcagctgcgtttctactggattaagttctacgataatctg
catgtgctccagtgctccggaagcttcgacttcggttacgagtacatgggtcttaatggt
cgcctggttataacacccctcacggatcgtatttacttaaccatcacccaagcgctgctc
atgaatctgggtggtgctcctgctggaccagctggaacgggtaaaacggagacggtcaag
gatctggccaaggccatgggtctcctttgtgtggtcaccaattgcggcgagggcatggat
taccgggcagtgggcactatactctctggcttggtccagtgcggtgcctggggatgcttc
gacgagttcaatcgtatcgacatctctgtgctcagtgtgatatcaacacagttgcaaacc
atcaggaatggcttaataaggaaactggatcggtttgtgtttgaaggggttgagatccat
ctagatcccaaatgcggcgtgttcgtgaccatgaatcctggctacgctggccgcacggag
ctacccgagtccgttaaggctttgttccgtccagtgacctgcatcaagcccgatctagag
ctgatctgcctgatctccctgttttctgatggattccttacagccaaggtattggccaaa
aagatgaccgttttgtactccctggcgcaggcgcagctgtcgaagcagtgccattacgat
tggggattaagatccctcaactccgtgctgcgaatggctggcgtaatgaagcggcagtct
gaggatctaccggaggcagtggtgctgatgcgagtgctgcgtgacatgaactttcccaaa
ttcgttttcgaggatgtaccattgttcctgggacttatcaaggatctgtttcctggtatc
gattgcccccgcatcggttatcccgacttcaatgccgccgtgcgtcatgtgctggtcaac
gatggctacatattgctgcccgatcaggaggacaaagtagtgcaaatgtacgagaccatg
atgaccaggcactcgaccatgttggtgggccctacaggtggcgggaaaactgtcgtcata
aatgccctggtcaaggcgcagacccacatgggcctgcccaccaagtgccttgtgcttaac
cccaaggcctgttctgtgatcgaattatacggctttttggatatggaaacgagggattgg
attgatggattgttttcaaatatatttcgtgaaatgaataagcccatcgagcgagaggag
cgacgttacgcctgcttcgatggagatgtggatgctctgtggatcgaaaacatgaactcg
gtgatggatgataacaagctactgactttggctaacggcgagcgcatccgtctggagaac
tactgcgccctgctcttcgaggtgggcaatctaaactacgcctctcccgctaccgtctcc
cgggcaggaatggtgtatgtggaccccaaaaatctgcgatacagtccgttctggcagcgg
tgggtgctaacccggccggagcctcagagggaactccttaacgacttctttgagaagatt
atcactcagtccatagccttcattctggagggcctggatggcactactcagggtaatccc
ctgaagctggtcataatgcaaacggacctgaacatggtaactcagttctgcaacctctac
gacgccctcctgcccaactatgttatggatagtaagaactacgatgagccggtgcagcag
aactacaatacagacagtttggagtgctgtttcctgcaagctgtctatggatccatgggc
gcttgcctcgtagagaagcatcagcctgtctttgatgagtatatgaagcgcatatccggc
tttccgttagtgcaggacacgccggagaatcccgcctcgggaggacagtttccgcagagc
aagcccacactgtacgactacttctgggacgtcaaggacaacgtttggaaggcctgggaa
tgggtggtgcagccgtacacacacgacccgcaagtgaagttcagtgagatcctggtgccc
acggtggacaacacccgtaccaatcggactctcagtctgatgagcgagatcaaacgaccc
gttctgcttgtgggagaggctggcacatcaaagacggctaccatcatgcaatatttgcgc
aatctcaatccgagtgtcaacgtcatactcaatattaatttttcatcgagaacctcatcg
ctggatgtgcagcacaccctggaggcggccgtggagaaacgcaccaaggatacgtacggg
cctccgatgggcaagagaattgcctgctttattgatgacatgaacatgccgcaggtggat
gactatggcacccagcagccgattgccctgctgaagctattctttgaacgcggcggcatg
tacgaccgcgacaaggatctcaactggaagaagtttaaggatctgaccttctacgcagcc
atgggaacagcgggtggcggcaggaacgaggtggatccccgatttatcagcatgttctcc
acctacaacatcatattccccaacgatgagtccctcatccagatctactcctccatcttc
aagggacatatggtattcgtgaagttccagcccgagtacatgcttatagccgacatgatt
gtccatatgacattaaaactttttaagatggtgattgtggacctgccaccgacgccctcc
aagttccactacattttcaatctgaaggatctgtcgcgtatcttcgccggaatgctgctc
atcgaacccacttgcttcaaggggctgagggacctgattagggtgtggcgcaacgagtac
accaggatcatatgcgatcgcctgataaccgataacgacatcgcaaatgttcgtcgaaat
ctggcagtggaagtggccgaacggtttcccccaactttcgaggaggagcatggatttatt
gatgcagcagcagcggaagcagaggcacaggctcgtttgctctatgagccatccaaggct
gacatcgatggaggagaggaagagggcgaagaggaagaggagggcgaggaggcgcctcag
gtgatactctcgctcaaggactacgtcctgcgcgatccgctgctctttggagatttccgg
aattttaccaatgaatctgagcctcgtttatatgaggatcttttggactacaactctgta
tactttctattcacggagatcctagaggaatactgtgaacgcaaacaaaagatgacattg
gtcctgtttgaggactgtctggagcatctgacccgcgtccatcggacgctgcgcatgaat
cgcggacatgtgctgctcattggagtcggtggcagcggcaagaagtgcattactcgtctg
gccgcctttgccgccgaatgtgatgtctttgagattaccatttcccgtggttacaatgaa
gccgcgttccgcgaagatctaaaggtcctttacaccatagcgggcgtgaagcgaaagaag
gtcgtgttcttgtttacgggagcgcaggtagcagaagagggcttcttggagttgatcaac
aacatcctgacagtgggccaagtaccagccctgttccccgatgaagacaaggatggtatc
gtcaatcaagtgcgcaagttcgccgaagaggatggagtttcggcatccaaagacgctgtt
tggggttacttcctccgcacctgtgcggaaaacctgcacgtggttctatgtatgtctccg
gctggcgatgcgctgcgcaatcgttgtcgaaacttcccgggtctcattggcagtacctat
atcgattgggtgttcccgtggccccgacaggctttgtacgcggtggccaaacttttcctg
accgagcaccgccttattccggccagccatcgagaggccatagtggagcatgtagtccat
gtccatacttccatacagcagtactcaaaggactatctggcaaaactaaggcgtaacaat
tttgtcacccccaaacactacttggactatattaacacctatagaggattgttggaggaa
aaggccaaattcattacccagcaacgttcgcgtctcggcgagggcatcaaaaaaatcgag
gaagcttccgtgcaaatcgacgaactgcgtattattgtcacggagcaaaagaagaacgtg
gctgtcgcctccgaggagtgcgaggctatgttggtcactatcgagtcctccactcaaaag
gctaatgtcaagaaggccgaggcgtcggaaaagtctgttgaggtggagattaagggaaaa
cagattgctatcgaaaaggacgaagccgaggagattctggcagaggcgatgccagctctc
gaggaggccagattggctctatcccaactcgaaaaggcgcagatcactgagatccgatcc
tttgccacgcccccagccgccgtgcaagtggtttgcgaatgcgtggctattctaaagggc
tataaggagataaattggaagagtgccaaaggaatgatgagcgacgtaaactttctaaag
agcttgatggagatggattgcgaggctttgacccagaagcaaataacccagtgccgacag
catatgaagactggcaacctagaggacatggcgaagatatccgttgctggagctggatta
cttagattcgtcagagctgtgctcggcttcttcgatgtatataaagaggtcaagcccaag
aaggaacgcttggacttccttgtggaagagcaagaagtacagattaagctgctgaatcac
ctgaacggagaaatccaaaagttggaggagaagctaaacgagttgaacgagaattatgct
acatccatgaaacagatgcgtgcccttactgaaatgatgcagcaggccgagcgtcgtctg
attgcctccgacaagttgatcagtggcttgacctctgagttaatccgctggagcaaagag
atggctagcctgggacagcagcttatcgacagcgtgggtgggtgcctgattagtgcctca
tttttggcctacacaggcgcctttacatgggagtttcgcaaggcaatggtcttcgacgat
tggctggaagacattgcgtccctgggaattcctatacagctaccatttaaaatcgatggt
tacctcactaccgacgtcgagatctcccagtggagcaacgagggcttgccgcccgacgag
ctttcaatccaaaatggcatccttaccatgcgcgcatctcggttcccactctgcattgat
cctcaactgcaggcgttgcagtggattcgcaaaagggagttcaaaaacaaccttaaagtt
ctttcattcagcgactctgacttcctcaagcaactggagatggccattatgtacggaacg
cctgtactattcgaagatgtggacgattatatagacccagtgattgacgacattctgcaa
aagaatattcgcattcagggtggtcgcaagttcgtcatgctgggtgacaaggaggtggat
tgggatcccagcttccgagtctacttaaccaccaagttctctaatcccaaattcgatccg
gcagtctatgcgaaggcactagttatcaactacacggtaacccagacaggattggaggac
cagttactaagcgttgtagtgggcaccgagcgtccggatcttgaggcccagcgtgagtcc
ttgatcgcccagaccagcgagaataagcagttgttgcagcaactggaggattcactgctc
cgcgagctgtccacctcgacgggcaacatgttggacaacgttgaactgattgaaaccctt
gagaacacaaaaactaaggcgggcgtcgtcatggaacagctaaaactggccgcggatacg
gcggcggacatcgaggtgctacgaaatggttaccgtccggctgccaaacgtggagctgtt
cttttctttgccctatcggacatggccacagtgaatagcatgtaccagtatgcactggcc
gcctatttggatgtgttcgtttactccctgcgaaaggctgtgccggatgctagtctcaac
aagcggttgaacaacatcatcaaaacgcttacggaaaacgtttactgctacgggtgcacg
ggcatctttgaacggcataagctgcttttctccttccaaatcgccactaaactcgcccag
cgggacggcattttgctgcaatccgagctggacttcttcattaagggcagcattgctcta
accaagagcgaacgctccaatccctgcaaatggctgagtgagaagagctgggaggatgtg
ctcaagttggccttcgatttcccagacattttcggcaccttaccagaccactttggtcgt
taccttaccgaatggaaagaatggttcgacttggagaatcctgaggaggtgccatgtccg
ggcgactacaacatcaaatgcaatgcattccagaaattaatgttcctgcgctgcttccgc
gtggatcgcatcttcaggagtataaatcaatacatcgtcgaaacgatggatgagttctat
atcatgccgccagtggtgagcttctcggccatatacgaacagacctccagcacgattccc
gtatgctttgtactgagtgccgggtcagatcccacaaatgatctaatcaaactggcggat
acgattgtcggcatgtccaacttttgtcacatatctctgggacagggccaggagaaggct
gctttgcgactcctggatggtgccatcaaacagggaatgtggctgatgctgcagaacgga
cacctgctgatcaggttcgtccgggaactggaaaagcatctagatcgcatagagaatcca
catccggactttaggctgtggataacaacagatcccacgcccacattccccattggcatt
ctgcaaaagtcgttgaaggtggtcactgagccacccaatggtctaaagctcaatctgcgc
tcaacgtacttcaaagtgcgtcaggagcgcctcgagagctgctctcatgtggctttccgt
ccattggtctatgtgctagccttcttccacgctgtcgtccaagaacgtcgcaagtacgac
aagctgggctggaacatagcgtacgatttcaacgacacggacttcgatgtgtgtactgaa
atcctgcgcacttacctaacacgatgtggcactgggaaaataccgtggaacagtttgaaa
tacctaattggcgaggtgatgtatggagggcgggtcatcgatgacttcgaccgacggata
accaactgctacatgaacgaatacatgggtgacttcctgttcgacgagtttaaggtattc
cacttctatgaggacgacaacgtggactactgcctgccggaagaggagaccattctgaaa
gaggactacatagcgcacatcgacaaactgccgctggtcaacaagccggatgtatttggt
ttgcatccgaacgcggaaatcggttattacacaatggcggcacgcaacatttggaacagt
ttgattgagctgcagccacagacgggtgagggaaccggtggaatcagccgcgacgacttc
atcgactcggtggcagccggcatactgaagaagctgccccccgccttcgagacatggcgc
atccgcaaacagatccagatgagcctgtcaccaaccggggtggtgctgctccaggagctg
gaccgctttaatctgctggtcgtacggatcaagaagacgctggagctgctacgcaaggcc
attgccggcgaaatcggcatggacaatgtgctggacaacattgccaactcgttgttcaat
ggcctcctgccagccgcgtggagcaagttggcgccggcgacatgcaaacagttggccagc
tggctggagcacttgcggcttcgggccgtgcaatacaaatactggacgctttcaggggag
ccactggtcatgtggctgtcgggactgcatataccgcagagttatctcacggccctggtg
cagattgcctgtcgccgcaacgcctggccgttggatcgctccacgcttttcacctacgta
accaagtttgcggaccccgacgatgtggaggagcgccctgtgacgggctgcctggtgcac
ggtctgtacatcgagggcgggcgctttgacttggccactaatcagctggcgcgttcccat
cccaaggtcctggttgaggagctggccattctcgccgtggagcccattgaggcgcaccgt
ctcaagctgcagaatacctaccttgccccggtatacacgacatcgctgcgcaggaacgcc
atgggtgtgggcctggtctttgaggctaatttggccacttcggaggatctgagtcactgg
attctgcagggcgtctgtctaaccctcaatacagatacctaa

DBGET integrated database retrieval system