KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18815Help
Entry
Dmel_CG18815      CDS       T00030                                 

Gene name
CG18815
Definition
(RefSeq) uncharacterized protein, isoform D
  KO
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmel_CG18815 (CG18815)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dmel_CG18815 (CG18815)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 221 aa AA seqDB search
MAAPVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWQQANNHL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccggtcattgtcgaggccacggtcaagcaaaccgccacgctgatcttcatg
cacggcctgggtgatacgggtcatggctggagcagtgccctagccgccatccgcccacct
ttcatgaaagtcatctgccccacggcgcccacacagcccgtttcgctgaacgccggcttc
cgcatgccgtcgtggtttgacctgaagacgctggacatcggtgggcccgaggacgagccg
ggcatccagtcggcgcgtgatagtgtgcacggtatgatccagaaggagattagcgctggg
attccggccaatcgcattgtcctgggcggattctcgcagggcggagccttggcactgtac
tcggcactcacgtacgatcagccgctggccggcgtggtggccctatcctgttggctgccg
ctgcacaagcagttcccaggcgccaaggtgaacagcgatgatgtgccgattttccaggcg
catggcgactacgatcccgtggtgccgtacaaattcggccagctgagcgccagcctgctc
aagtcgttcatgaagaatgtgacgttcaagacgtacagtggactatcgcactcgtcgtcc
gacgacgaaatggatgacgtcaaggacatcatcagtaaatggcaacaggcaaacaatcat
ctgtag

DBGET integrated database retrieval system