KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1885Help
Entry
Dmel_CG1885       CDS       T00030                                 

Definition
CG1885 gene product from transcript CG1885-RB (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG1885
Enzymes [BR:dme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dmel_CG1885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:8B6-8B6
AA seq 277 aa AA seqDB search
MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLDELRAKLQNPDKYAG
IIFTSPRCVEAVAESLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARA
LGDYIVDTFDGSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVER
ALEIYGESIEFLAFFSPSGVNCAQQYFTSRQLSMDKWKLVAIGPSTRRALESLGQKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERMAAIENNN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcgccagcgaactgtgatcatattcaaatcggaatcggaaagcagcgatgtg
tacgcagaaacgctggagaagcacgatttcaatcccgtctttgtgcccacgctgagtttc
ggcttcaagaatctcgatgagctgcgcgccaagcttcagaatccggataaatatgccggc
atcatattcacatcgccgcgctgcgtggaggccgtggctgaatccctcaatctcggcgag
ctacccggcggttggaagatgttgcataactatgccgtcggcgaggtgacccacaatctg
gcgctaagcaccttggaccagctattcacccacggcaaacagacgggcaatgcccgggca
ttgggcgactatatagtggatacgttcgatggatcgcgtgcattgccgctactattgcca
tgcggtaatctggccaccgatacgctgctatccaagctggccgagaatggcttctccgtg
gatgcgtgcgaagtgtacgagacgcgctgtcatcccgaattgggcgccaatgtggagagg
gcattggagatttatggcgagtcgattgaatttcttgccttcttctcgccatcgggcgtc
aattgtgcacagcagtacttcaccagccgtcagctatcgatggacaaatggaagctggtg
gccatcgggccgagcactaggcgtgccctcgaatcgctgggccaaaaggtttactgcacc
gccgagcggccgacggtggagcatctggtcaaggtgctgctcaatccgcaggacagtcgg
gagcggttgctcaaggagcgcgaacggatggccgccatcgagaataacaattaa

DBGET integrated database retrieval system