KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18858Help
Entry
Dmel_CG18858      CDS       T00030                                 

Definition
CG18858 gene product from transcript CG18858-RB (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmel_CG18858
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmel_CG18858
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dmel_CG18858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:38C7-38C7
AA seq 421 aa AA seqDB search
MRLKSGVLSLLLLTTFLALGECFWPFSKWHGRNDNPSAPPEPKLSPVIFVPGDGGSQMDA
RLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETR
IPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGYIRKQNIHGAPYDFRKAPNENQQFF
IDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGS
FKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPSRNYTMA
QLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVERLQYKKSDISGET
PKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaatcgggagtgctttcgctgctcctgctgaccaccttcttggccctgggc
gagtgcttttggccatttagcaaatggcatggaagaaatgataatccttctgccccccct
gaacccaagctgtcgccagtgatattcgtacccggtgacggaggctcccaaatggatgct
cggctaaataagcccaactctccctatttaatttgccaaaagacccacgattggtacaac
ctgtggctggatctggagcagttggtcatccccatggtctactgttggatagacaatgtc
aagctgtactacgacaaggtcacgaggaccacccacaacactcctggtgtggagacgagg
atacccggctggggcaatcccgaggtggtcgagtggatcgatcccaccaagaacagcgcc
ggagcctacttcaaggatatagccaatgagctggtgaaacttggatatattcgcaaacaa
aatattcatggagcaccctatgacttccgcaaagcgccaaatgagaaccaacagttcttc
atcgatctcaagcagctggtggaggactcctatgaggccaacaatcagtcggctgtgacc
ttcatctcgcacagcatgggcagtctcatgaccctggttttcttgcaggagcaaaccctc
caatggaaggcgaaatacgtgaagcgcatgatcagcctggcgggagtttgggcgggaagt
tttaaggctgtgaaagtgtttgccatgggcgatgatctcgactcgttcgccctgagtgcc
aagatcctcaaggcggaacagataacacacccatccacggcctggttgctgccctcgcca
ctgttttggaagccatccgaggtgctcgccatgactccaagcagaaactatacgatggca
cagctggaagagttcttcaaagacctcgactacatgacgggctgggaaatgcgcaaggac
acgattcggtacaaccgaaacttcgatccaccgaatgtggaactgcactgtctctatggc
gaaggcatcgacacggtcgagagactgcagtacaagaaatcggacattagtggggaaacg
cccaagttgataatgggtctcggcgacggcaccgttaaccagcgttctctgcgagcctgc
aaatattgggcgggctattctaaagcgcctataaacacgctcgctctccagaacgtggac
cacttgcacatcctgtccaatccggacgtcctcaaatatatccgcactgtcatgcagcag
ccgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system