KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1894Help
Entry
Dmel_CG1894       CDS       T00030                                 

Definition
CG1894 gene product from transcript CG1894-RA (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG1894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:98D2-98D2
AA seq 421 aa AA seqDB search
MDKENRSGDHLKYQPLGDQDGISSKLPDIPRALQLTNAKESSATRGLGQSASKSEMGKSQ
LQNDSSLQKNIQETKTITGSCIEAQRIGATPKKQLEGVKEPNMISLLHTNASSNVDDRQR
QETIDNEKSDVQKEKEDAKVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYVCEFC
LKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLEN
KKILYSSSSFLFYILCLKDKDGEHFAGYFAREKTMLNINLNCILVLPPYMRKGYGKLLID
LSYEISRREACIGGPKKPLSKVARLCYLSYWGHILLNLLRHHSSPDLVTIEELSKATGFR
EEDIISTLEFMGMTKYYKVDHIMFYTTSSIIEDRRGLAQFKKPRLTIHRNRLSWKTPTGR
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggaaaacagatcaggtgaccatttaaagtatcagccgttgggcgatcaggac
gggataagttcgaaattgccggacattccgagagccctgcaattgactaatgccaaggaa
tcctccgcgactcgcggtttaggccaaagtgcttctaagtccgaaatggggaaatcccag
cttcagaacgattcatctcttcaaaaaaacattcaggaaactaaaaccattactggatcg
tgcatcgaagctcaaagaataggggctacaccgaagaagcaattggaaggcgtcaaggaa
cctaatatgatttctttattacacactaatgccagtagcaatgtggatgatcgccagcgc
caggagacaatagataatgaaaaaagtgatgtccagaaagagaaagaggacgcgaaagtg
aaagtcataagaaacatcgaaaaggtgcaatttgggcgttacgagatcgagaccacgtct
tccagtccctatcctgtaataaacgacaaggcgaccaccatttacgtttgtgaattctgc
ctaaaatacatgtgcttgcggaaaagttactcctaccacctatacgattgcaagaagagg
tgtccgccgggcagcttgttataccgaaaagacaatatttatatctacgaggtcgatggc
cataaggagcagctgtattgccagtgcctctgcctaatgtcaaagctctttctggaaaac
aagaaaattctttacagctcgagttcgttcttgttttatatcctgtgtttgaaggacaag
gatggcgagcactttgcaggttacttcgccagggagaagactatgctgaatatcaacctg
aattgcatccttgttttaccgccctatatgcgcaagggatacggaaagttgttgattgat
ctgagctacgagatctctcgcagggaggcatgcatcggaggtcccaagaagccgctgtcg
aaagttgccagactttgttacctcagctattggggccacatcctcctcaatctgctgagg
caccactcatcaccggacctggtgaccatcgaagagctgagcaaagcgactggcttccgc
gaggaggacataataagcactttagaatttatggggatgacgaagtactacaaggttgac
cacatcatgttctacactacttcatcgataattgaagatcgccgtgggctcgcacagttt
aaaaagccgaggttgaccattcacaggaatcgcctctcctggaagacacccacaggacga
aagtag

DBGET integrated database retrieval system