KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1950Help
Entry
Dmel_CG1950       CDS       T00030                                 

Gene name
CG1950, Uch-L5R
Definition
Uch-L5-related (EC:3.1.2.15 3.4.19.-)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG1950 (CG1950)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dmel_CG1950 (CG1950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11A2-11A2
AA seq 340 aa AA seqDB search
MDTENPGAATVEELTTKEATAANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAF
RHLEPIHGLIFLFKWLDDKPAGRVVTDRSDIFFARQVIPNACATQALLCLLLNLQHEDID
LGQTLTDLRNLCQDLDPECRGHRLANEEKIRKVHNSFARPELFVVEESTDFIEDDCYHFV
GFMPIKGKLFELDGMHEGPIELADIDQQQNWLDVVRPIIEARMERYSVGEIHFNLMALVS
DRQRCYERKIQMLVNLPSQLSHADRQAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPF
IVELLKQLGETGQLMAICDKAKDRSYLCKPSKDTRDQQPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacacagaaaatcctggagcagcaaccgttgaggagttaaccaccaaggaggcaaca
gccgcaaacaactggtgcctgattgaaagcgatccgggtgtcttcaccgagatgattagt
ggttttggctgcacgggtgccgaggtggaggaaatctggtccattaaagcggacgccttc
cgtcacctggagcccatccatggcctaatctttctgttcaaatggttggatgacaagccc
gctggtcgcgtggtcacggatagaagtgatatcttctttgctcgccaggtgataccgaat
gcctgtgccacgcaggctctactctgcctgctgctcaatctacagcatgaagacatcgat
ttgggtcaaactttgaccgatttaagaaacttatgccaggatctagatccggaatgccgt
ggacaccgtttggccaacgaggagaagatccgtaaagtacacaattcatttgctcgaccc
gaactcttcgtggttgaagagagcacggatttcatagaagatgattgttaccactttgtg
ggctttatgccaataaaaggcaaacttttcgaattggacggaatgcatgagggtcccatc
gaactggccgatatcgaccagcaacagaactggctggatgtggtcagaccgattattgag
gcacgcatggaacgctacagcgtcggtgagatccacttcaatctaatggccctggtctcg
gatcgtcagcgatgctacgagcggaagatccaaatgctggtcaacctaccatcgcaacta
agccacgcggatcgtcaggcggagatcgccaacctaagatcccatgtgaggcacgagaag
gagaagaagcgtcgctatcgcaaggagaacattcgtcgccgccacaattatctgcccttc
attgttgagctactaaagcagctgggcgagactggccaattgatggccatttgtgacaag
gccaaggatcggtcttatctatgtaagccgagcaaagatacaagggaccagcaacctcaa
taa

DBGET integrated database retrieval system