KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1986Help
Entry
Dmel_CG1986       CDS       T00030                                 

Definition
CG1986 gene product from transcript CG1986-RA (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerolipid metabolism
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dme00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:9A3-9A3
AA seq 404 aa AA seqDB search
MPGHVNHLLLLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVF
ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYS
LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GYECGSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPYVPRRQTNWLSGVGRM
SSSKVSQVSQSPLVLRLWTNSWRRRERARERQRRDRDRESDRCA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcacgtgaaccaccttctgctccttggctgcctgctctgcctgctcggcgat
gtgccgagaatcgaggctttccaccgctggagtcccatgatgaaggccttccgctatctc
caggagaccatgctccggaatagcctggaacgtgcccatctcaatcatggcatcgtcttc
gagtgtcgcaccatatcagctaaggattttggtaatgaagtgcatttcaatctgcagctt
ggagaccttcgaggatttcgtcgcctcgatcctaacaaaaagttggccctatttttgcac
ggctggaatgatcagggcagcaaggattgggtgcaagagttattgctaacttggacccta
ttcgactccaattacaatgtgtgcgttgtggactggggaaatctgtcgcagaacgactac
aagtccgcatccatgtccattttcgatgtgggtctaacggtggctggaatcatcatggcc
ctggaggagctgcgtcccaatcactttcatcgaagcaacgtgaccttggcgggctacagc
ttgggtgcccatgccgctggatatgcgggcgcagtgttggagggtcaggtggagcagatc
ataggcttggatcccgctggaccgctgttctcgctgcccgccgaggtggcgcccaagtac
cgcctggatccaggagatgcgcagttcgtccaggtacttcacacttccggcggctccttg
ggcaccagtctgaagtgcggccacgccgatttctatcccaacggaggcagggcgccgcaa
acgaattgcaagatgttcgccaatctgcgtgacatgcaaaataccaatcccgtttcctgc
agtcactcggcggctgcgatcttcttccggcaatcgatggatcccgagtacccgttcgtg
ggctacgagtgcggcagctaccgggaattcgccgccggatattgcgatggcaaccggaag
gcgcgcttcggtatccattcgcagaggcgtgcgcagggtagcttctatttccgcaccgcc
ccccagcagccgtacgtgccgaggcgtcagaccaactggctgagcggggtggggcgaatg
tcgtcgagcaaggtcagtcaggttagccaaagccccctggtgctgcgcctctggacgaac
agctggcggcggcgcgagcgagcgagagagcgacagcgaagagacagagacagagagagt
gatcgctgtgcgtga

DBGET integrated database retrieval system