KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2051Help
Entry
Dmel_CG2051       CDS       T00030                                 

Definition
CG2051 gene product from transcript CG2051-RB (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG2051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:83C4-83C4
AA seq 405 aa AA seqDB search
MAQIEKYQDFVIDALEVVDFKLIRDKADINNDALTFHPAMAHQIFGETETIFGYQDLHVR
VMYTAGPLHIYLGVDYGKRVNEISGGEIKADDVVSTIAQSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKISEYRRVSDDGSERLFEIYQCEYKSSSFLKFFARLQTFILWFVDAASYIDT
DDPQWCYFLSYEKYKNNDGQWQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLA
TQLVESIYRFYQSQKNVVDITVEDPSEDFQRLRNFVDARSCMKLKSFAPGEIVKGFNKEM
VREAREALKLNPLQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKM
ERFKMDTEMLRARLPTVQQRMEQLHEEYRVVEQEYQSTIAKLRAS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatcgagaagtaccaggactttgtgattgatgctctcgaagtggtagacttt
aagctgatccgtgacaaggccgacatcaacaatgatgccctgacctttcatcccgcaatg
gcccaccagattttcggggagaccgagacgattttcggctaccaggacttgcacgtccgt
gtaatgtacacggcaggacctttgcacatctacttgggcgtcgattacggcaaacgggtg
aatgagatctccggcggagagatcaaggcagacgacgtcgtcagcacaattgctcagagt
ctaccggacggctgctacttcatcaatcttgatgagtttcttaagacactggacaaggct
gacaaatttcagcccttcggtgagaagataagcgaatacaggcgggtatcggacgacggc
agcgagcgccttttcgagatctaccagtgcgagtacaagagctcatcattcttaaagttc
tttgcccggctgcagacgttcatcttgtggttcgtggatgctgcctcctacatcgacact
gatgatccacagtggtgttacttcttgagctacgaaaagtacaagaacaacgatggccag
tggcagtatgccacagctggttacaccaccgtatacgagtactacgcctatccgcaaaac
aagaggcccaggataagccagatgctgatactgccgcctttccagaaactcggcttggct
acccaattggtcgagagcatttacaggttttatcagtcacagaagaatgttgtggacata
acagtggaggatccatctgaggatttccagcgtttgaggaattttgtggacgcgcgatct
tgcatgaaattgaagtcgtttgcaccaggcgagatagtcaagggcttcaacaaggagatg
gtgcgggaagctcgcgaggctctgaaactcaatcccctccaggtgcgtaaggtgtacgag
cttttgcgtttattctacaccaatgtgaaggatgaaaaggagtaccgaccctatcgtctg
gaagttaagaaacggcttaacgcggtctattacaagcagttaaaggatttgaagaaaatg
gagcgcttcaagatggacactgaaatgctgcgtgctcgcctgccaacggttcaacaacga
atggagcagctgcatgaggaataccgcgtggtcgagcaggagtaccagagcaccattgcc
aagttgagggcctcgtag

DBGET integrated database retrieval system