KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2152Help
Entry
Dmel_CG2152       CDS       T00030                                 

Gene name
Pcmt
Definition
Protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dmel_CG2152 (Pcmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3R:101F-83B1
AA seq 203 aa AA seqDB search
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAEL
VRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLAS
GGRLIVPVGPDGGSQYMQQVGRC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgatccgtgggagccaataatgaagacctgattcgccaactgaaggatcac
ggcgtcattgcaagtgatgcggtggcccaggcgatgaaggaaaccgaccgcaagcactac
tctccgcgcaacccctacatggacgccccgcaacccattggaggaggtgtcaccatcagt
gctcctcacatgcatgccttcgccttggagtatctacgcgaccacttgaagcccggtgca
cgtatactggatgtgggctctggatctggctacctcacagcctgcttctatcgttacatc
aaggctaagggcgttgatgcggacacccgaatcgtgggcatagagcaccaggcagagctg
gtgcggcggagcaaggccaacttaaacaccgacgaccgtagcatgctggactccggccag
ttgctgatcgtcgagggtgacggccgcaagggataccccccgaacgccccgtataatgca
atccatgtaggagcagctgctcccgacacacccaccgaactcatcaaccaactggccagc
ggcggacgcctgatagttccagtcggtcccgacggcgggtctcagtacatgcaacaggtg
ggcagatgctga

DBGET integrated database retrieval system