KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2185Help
Entry
Dmel_CG2185       CDS       T00030                                 

Gene name
elm
Definition
ethanol sensitive with low memory
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmel_CG2185 (elm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:83B8-83B8
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataagtcgtcgcttttcctgcggaacgaggagatcgcgcaaatccaggaggag
actggcttcacccccaaccaaatcgagcgactttactcgcgcttcacctccttggatcgc
aatgattgcggaaccttgtcccgggaggatctgatgcgtatcccggaactggccattaat
ccgctgtgcgagcggatagttcattcctttttcgctgagagcaacgacgatcgggtgaac
ttccggcagttcatgaacgtcctggcccacttccggccgctgagggataacaagcaaagt
aagctcaacagccgggaggagaagctgaagttcgccttcaagatgtacgatctggatgac
gatggtgtgatcagcagagacgagctgctctccatcctgcacatgatggtcggggcgaac
attagccaggaccagttggtcagcattgcggagaggacgatcctggaggcggacctgtgc
tgccagggcaagatctcgttcgaggacttctgcaaagctctggaccgcaccgacgtggat
cagaagatgtccatacggtttctcaactag

DBGET integrated database retrieval system