KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2201Help
Entry
Dmel_CG2201       CDS       T00030                                 

Definition
CG2201 gene product from transcript CG2201-RF (EC:2.7.1.32 2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmel_CG2201
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dmel_CG2201
    2.7.1.82  ethanolamine kinase
     Dmel_CG2201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:39E3-39E3
AA seq 240 aa AA seqDB search
MKQRNLRNNKALKRLQQPDNKNLNCCLSKRCNYENIWQHFNSNATLEEIRHAAARICRDY
LTGPWKVVTPESLVVKRISGGLSNFLYYVSLPDLNDYDELDEQKQQQEDIIGATATVTNR
SGVFIHDDESAAKAVGVTLMARELINNDDVADAAPGATQAHKRQRCDSNSRECSSSKRLH
APKQQPREVLLRIYGQTHGDHALESMITESVVFALLSERNYGPKLHGIFPGGRIEQYIPV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgaaatcttaggaataataaagcactcaaacgcctccagcagccagataat
aaaaatctaaattgttgcttgagtaaacgttgcaactatgaaaatatctggcagcatttc
aatagcaatgccacccttgaggaaattcgacatgcggccgcgcgtatttgccgagactat
ctaactgggccctggaaagtggttactccggagagtttggtagtgaagcgcataagtggc
gggctgtcaaatttcttgtattacgtaagccttcccgatttaaatgactacgatgagctg
gacgaacagaaacagcagcaggaagacatcataggggccaccgcaactgtgaccaataga
agcggagttttcatacacgacgatgagtcggctgccaaggcggtgggcgtaacattgatg
gcgagggaattaataaataacgatgacgtcgccgacgcagctcctggcgccacacaagca
cacaaacgtcagcgatgcgatagtaatagtcgcgaatgcagttcttcgaaacgattgcac
gcccccaagcagcaaccccgtgaggtccttctgcgaatatatggtcagacccatggtgat
cacgccctggagagcatgattaccgagtccgtggttttcgcccttctcagtgaacggaac
tatgggcccaaactgcacggaatctttccgggcggacgtattgaacaatatattccggta
tag

DBGET integrated database retrieval system