KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2212Help
Entry
Dmel_CG2212       CDS       T00030                                 

Gene name
sws
Definition
swiss cheese (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmel_CG2212 (sws)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dmel_CG2212 (sws)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:7D1-7D1; X:1-22 cM
AA seq 1425 aa AA seqDB search
MDVLEMLRASASGSYNTIFSDAWCQYVSKQITATVYMYFALVMMSLLFIAWFLYFKRMAR
LRLRDEIARSISTVTNSSGDMRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKRR
AVMRFARRILQLRRDNMPLEMRTVEPPAEYLEETIEGSDRVPPDALYMLQSIRIFGHFEK
PVFLRLCKHTQLLELMAGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKGE
SVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMQAFEEVFQDNPDVMIRVIQVIMI
RLQRVLFTALRNYLGLNAELVQNHMRYKSVSTMSGPINSQTSQSSRQAPNGPPMVISQMN
LMQSAVSGTGSSGVSVTVTRPPSSPSRHSREEHTLSDPNPNPDGSFHGTTNLFTEVHGDA
PNADLFHQQQQQHSVGNLSTRRSSITLMAPDGSHSCLQTPGVTTSIDMRLVQSSAVDSLR
KELGLSEEDSHIIEPFVELRELEPNVTLITEGNADDVCVWFVMTGTLAVYQSNQDATRAK
QDKSDMLIHFVHPGEIVGGLAMLTGEASAYTIRSRSITRIAFIRRAAIYQIMRQRPRIVL
DLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDESSDSTYIVLSGRMRSVITHPGGK
KEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKLIS
FLSHRFLGSMQTRSGSGAPGAPVEANPVTHKYSTVALVPITDEVPMTPFTYELYHSLCAI
GPVLRLTSDVVRKQLGSNIFEAANEYRLTSWLAQQEDRNIITLYQCDSSLSAWTQRCMRQ
ADVILIVGLGDRSHLVGKFEREIDRLAMRTQKELVLLYPEASNAKPANTLSWLNARPWVT
KHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGAR
GAAHIGMLKAIQEAGIPVDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQ
LLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDITASCHRIHTNGSLWRY
VRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPADVMHNLGAAHIIAIDVGSQDDTDLTN
YGDDLSGWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPID
KYKTLAFGSFDEIRDVGYVFGKNYFESMAKAGRLGRFNQWFNKEPPKRVNHASLNEYTFI
DLAQIVCRLPETYAVNTAELFSEDEDCDGYISEPTTLNTDRRRIQVSRAGNSLSFSETEM
DSDVELDLKLERKTDKSTQSSPPSNSRSDMRGKEEARHMSNWHWGVKHKDETGSGATEAT
KTQTGQEQELQQEQQDQGATAEQLVDKDKEENKENRSSPNNETKN
NT seq 4278 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaaatgctgcgcgccagcgccagcggcagctacaacacaatattctcg
gacgcgtggtgccaatatgtctccaagcagatcacagcaacggtgtacatgtatttcgcc
ctggtaatgatgagcctgctcttcatagcctggttcttatacttcaaacgaatggcacgt
ttgcgtttgcgcgacgagattgcccgttccattagcaccgtaaccaattcatccggcgat
atgcgtggcctgcgtttccggaagcgtgacaagatgctattctacggccgtcgaatgctg
cgcaaaatgaagaacgtgagcggtcaaatgtacagcagcggtaagggctacaagcgtcgt
gctgtcatgcgtttcgcgagaaggatactccagctgaggcgggataatatgccgctagag
atgcgcaccgtggagccgccagccgagtatctggaggagacaatcgagggcagcgataga
gttccgcccgatgcactctatatgctccagagcattcgcatttttggacatttcgagaag
ccggtctttttgcggctctgcaagcacacccaattgctggaactgatggccggcgactat
ttgtttaagataaccgatccggacgatagcgtctatatcgttcaatcgggcatgatcaat
gtgtacatctccaatgccgatggcagcacactatcattgaagacggtcaggaagggcgag
tcggtgacatcgctgctcagctttattgatgtcctgtcggggaatcccagctactataag
acggtcaccgccaaagccattgagaaatcggtggtcattcgtctgcccatgcaggcattc
gaagaggtgttccaggacaatccggacgtaatgattcgcgtcatccaggtgattatgatc
cggctacaacgcgtactgttcaccgctttgcgcaactacctcggtctaaatgccgaactg
gtgcagaatcacatgcgctacaagagcgtatccacaatgagtggaccgattaactcgcag
acctcgcaatcctcacgccaggcgcccaatgggccgcccatggtgatcagccagatgaat
ctgatgcagtccgctgtttcgggaacgggatcatcgggtgtctcggtgaccgtaactcga
ccaccatcctcgccatcgcgacactcgcgcgaggagcacacgctatccgatccgaatcca
aatccggatggtagttttcacggcactaccaatctgttcaccgaggtgcatggcgatgcg
cccaatgcagatctattccatcagcagcagcagcagcattcggtgggcaacctatccacg
cgtcgcagttccataactctgatggcacccgatggttcgcactcgtgtctacagacaccc
ggtgtgacaacctcgatagacatgcgcctggtgcaatcctcagcggtggacagcctacgc
aaggaattgggtctgtccgaggaggattcccacatcattgagccttttgtagagttaagg
gaactggagccgaatgtcaccctgattacggagggcaatgcggacgatgtttgcgtttgg
tttgtgatgacgggcacattggctgtttaccagagcaatcaggatgccacgcgggccaag
caggataagagcgacatgctcattcactttgtgcatcccggcgaaatcgttggtggactg
gccatgctaacgggagaggccagtgcgtataccattcgatcgagaagcatcaccagaata
gccttcatccgacgagcagctatttaccagatcatgcgacaacgaccacgcattgttttg
gatctgggcaacggagtagtacgccgtctatcgcctctggtgaggcagtgtgactatgcc
ttggactggatctttctggaatcgggcagagctgtctatcggcaggacgagagcagcgac
agcacatatattgtgcttagcgggcgaatgcgttcggttatcacgcatcctggtggcaaa
aaggagatcgtcggcgaatacggcaagggggatcttgtgggcatcgttgaaatgatcacg
gaaacgtcgcgcaccacgacggtgatggctgtgcgcgactcggagctggccaagctgccc
gagggcctgttcaatgccatcaagctgcgctaccccatcgtggtgaccaagctgattagc
ttccttagccaccgcttcctcggctcgatgcagacgcgctcgggcagcggggcgccgggc
gcgcccgtcgaggccaatcccgtcacgcacaagtactccacggtggccctggtgcccatc
accgacgaggtgccgatgacgcccttcacctacgagctctaccactcgctctgtgccata
ggacccgttctccgtttgacctccgatgtggtgcgcaagcagctgggctccaacatcttt
gaggcagccaacgagtatcgtctaacctcgtggctggcgcagcaggaggaccgaaacatc
atcaccctctatcagtgtgacagttcgctgagcgcgtggacacagcgctgcatgcgacag
gctgacgttatcctgatcgtgggcctcggcgatcgatcacacctggtcggaaagttcgaa
cgcgagatcgaccggctggcgatgcgaacgcaaaaggagctcgtcctgctatatccggag
gccagcaatgccaagccggccaacacgcttagttggctaaatgcccgaccctgggtaaca
aagcaccaccatgtgctctgcgtcaagcggatcttcacgcgcaaaagtcaatatcgcatt
aatgatctctatagtcgcgtcctgctgtccgagccaaacatgcattccgacttctcgcgt
ttggcgcgctggcttacgggcaactcgattggcctggtgctgggcggcggaggagcgcgt
ggagctgcccacattggtatgctgaaggccatccaggaggcgggcatacctgttgacatg
gtgggcggcgtcagcatcggtgccttgatgggagctctctggtgctcggagcgtaatatc
accacggtaacgcagaaggcgcgcgagtggtcaaagaaaatgacgaaatggttcctacaa
ctacttgacctcacctacccgatcacatcgatgttctccggacgagagttcaacaagacg
atccacgacactttcggggacgtgagcatcgaggacctgtggataccctacttcaccctc
accaccgacataaccgccagttgccatcgcattcacaccaatggatctctgtggcgttac
gtacgctcctccatgtcgctcagtggctacatgccgccgttatgcgatcctaaagatggg
cacctcttgctggatggcggctatgtgaataatctgccagccgatgtgatgcataatctt
ggagctgctcacataatcgccatcgatgtgggatcccaggatgacactgacctgaccaac
tatggcgacgacctaagcggttggtggctgctctacaagaaatggaatcccttcacatcg
cctgtgaaggtgcccgacttgccggacatccaatcccgactagcctatgtgtcctgcgta
cgccaactagaggaggtcaaaaactccgactactgcgagtatatccgaccgccgatcgat
aagtacaagactctagccttcggcagcttcgacgaaattcgagacgtgggctatgtgttt
ggcaaaaactactttgagagcatggccaaggctggtcgattgggccgcttcaatcagtgg
ttcaacaaagagccacccaagcgggttaaccatgcctccctcaacgagtacacgttcatc
gatctggcgcagatcgtgtgccgtctgccggagacatacgccgtgaataccgcggaactc
tttagcgaggacgaagactgtgatggctacatttcggagccgaccacactgaatacggat
cggcgtcgcatccaggtgtcgcgcgctggcaactcgttatccttttccgaaacggaaatg
gactcggacgtggagcttgacctgaagctggagcgcaagacggacaagtccacacagtcg
tcgccgccgagtaacagcaggtcggacatgcgcggcaaggaagaggctagacatatgtct
aattggcattggggtgtgaagcacaaggatgagactggcagcggagccactgaagccaca
aaaacacaaaccggtcaggagcaggaactccagcaggagcaacaggatcagggagctacg
gctgagcagctggtggataaagacaaggaggagaacaaagagaacagaagtagcccgaat
aacgaaaccaaaaactag

DBGET integrated database retrieval system