KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2222Help
Entry
Dmel_CG2222       CDS       T00030                                 

Gene name
Psf3
Definition
(RefSeq) Psf3, isoform B
  KO
K10734  
GINS complex subunit 3
Organism
dme  Drosophila melanogaster (fruit fly)
Module
GINS complex
Brite
DNA replication proteins [BR:dme03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   GINS complex
    Dmel_CG2222 (Psf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
X
AA seq 212 aa AA seqDB search
MNGMNYFPNYYSIEDIFVTQEKVECRVNTKLQRMGFLDSGAESDDLEPGRTVNLPLWYIK
ELKVNNAYFTVAVPDIYRNVHKAVCEAETTHIELGRLHPYFYEFGRYLTPYDRNHVIGRI
IFETLRQRVRHLLDISKSDGQAAKAEHRLDNIEAKLHEAGVRTNSQYIEWLQMTGNKIRT
SELVEEHQKKRRRADRSDDEGDALPNSKRATL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaatgaactattttccgaactattactccatcgaggacatattcgtgacccag
gagaaggtggaatgtcgggtgaacaccaagctgcagcggatgggattcctggactccggc
gcggaatcggatgacctggagcccggcaggacggtcaatctgccgttgtggtacatcaag
gagctgaaggtaaacaatgcctacttcaccgtcgccgtgccagatatctatcgcaatgtg
cataaggccgtctgcgaggcggagaccacgcacatcgagctgggacgcctgcacccgtac
ttctacgagttcggtcgctatctgacgccctacgatcgcaaccatgtcatcggccgcatc
atcttcgaaacgctgcgccagagggtacgtcatctcctggacatctcgaagagcgacgga
caggcagccaaggcggagcatcgactggataacatcgaggccaagctgcacgaggctgga
gtgcgcaccaacagtcagtacatcgaatggctgcagatgacgggcaacaagattcgcacc
tcggagctggtcgaggagcaccaaaagaagcggcgacgtgcggatcgcagcgatgacgag
ggcgatgctctgcccaacagcaagcgggccaccttgtaa

DBGET integrated database retrieval system