KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2224Help
Entry
Dmel_CG2224       CDS       T00030                                 

Definition
CG2224 gene product from transcript CG2224-RB
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dmel_CG2224
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG2224
Peptidases [BR:dme01002]
 Metallo Peptidases
  Family M67
   Dmel_CG2224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99F5-99F5
AA seq 420 aa AA seqDB search
MSKAVNNMSMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQRE
YEQFLASKEAERVKELERERERERERQRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSA
PDLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSYNRTD
SLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGT
PDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVC
APKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLRR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaataacatgagcatgggcgacgtggagccgcaggagaggatgaag
cacctgtcgcactgcggcaacctgatcgaggtggacaagaacatgccagtcacgcggtac
taccgctctggcaccgagatgctgcgcatggccaatgtttacctgcgggagggcaaccac
gagaacgcattcatcctgtacttgcgctacatgaccctcttcatcgagaagatccgccag
cacccggattatggcagcgtcaaggccgaggtgcgggatattaacaggaagattaaggac
gagattatgcccacgacggagaaactgagagccaagctactaacgcactaccaaagggag
tacgagcagttcctggctagcaaggaggcggaacgagtcaaggaactggaacgcgaacgg
gagcgggaaagggaacgtcagcgacaaaaggaaagggagaaggcaggttcaagtgctatc
ccatccctcatcccggccaatttgcacgtgctcatcgacgaaggcaaccagccatcggct
ccggacctgggcctgcttgaccaggtggtctaccccaatgactttcccacgggcgccaat
cgcagcctgccgggatcgggactcctgctgcccgctgccagcgaagcagccgccgacaag
acaaccaactccaagccaagcttcgatcgcaatcagaagccatcttacaaccgcacagat
tctctgctggctggctctttgcgcctcgtttacgtgcccggggacaccatggaggtgttt
ctgaagctggcccttgccaacacctcgaaaaacatcgagacatgcggcgtactggctggt
catctgtcccagaaccagctgtacatcactcacatcattacgccgcaacagcaaggaact
ccggacagctgcaacacgatgcacgaggagcagatattcgatgtgcaggaccagatgcag
ctgattacgctgggatggattcatactcatccaactcagactgcgtttttgtcctccgtt
gacctgcatacgcattgctcctatcagattatgatgcccgaagctttggctattgtgtgc
gcgcctaagtacaatactactggtttctttatactcacgccacattacggtctggactac
atagcccaatgtcgccagtcgggctttcatccgcatcctaatgacccgccgctcttcatg
gaggcgcagcacatccgaatggataaccaggccaaaatcaaggtcatcgatctgcggaga
tag

DBGET integrated database retrieval system