KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2759Help
Entry
Dmel_CG2759       CDS       T00030                                 

Gene name
w
Definition
white (EC:3.6.1.3)
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:3B6-3B6; X:1-1.5 cM
AA seq 687 aa AA seqDB search
MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNYGTLRPPSPPEDSGSG
SGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERHIPAPRKHLLKNVCGVA
YPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVDAKEMQARCAYVQQ
DDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHTIIGVPGRVKG
LSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVILTIHQP
SSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCPTNYNPADFYVQVLAVVPGRE
IESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQPENGYTYKATWFMQFRAVLWRS
WLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVGVMNINGAIFLFLTNMTFQNVFA
TINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPLFLTVPLVFTAIAYPMIGLRAGVL
HFFNCLALVTLVANVSTSFGYLISCASSSTSMALSVGPPVIIPFLLFGGFFLNSGSVPVY
LKWLSYLSWFRYANEGLLINQWADVEPGEISCTSSNTTCPSSGKVILETLNFSAADLPLD
YVGLAILIVSFRVLAYLALRLRARRKE
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagaggatcaggagctattaattcgcggaggcagcaaacacccatctgccgag
catctgaacaatggtgacagcggagcggcttcgcagagctgcattaaccagggcttcggg
caggccaaaaactacggcacgctccggccacccagtccgccggaggactccggttcaggg
agcggccaactagccgagaacctcacctatgcctggcacaatatggacatctttggggcg
gtcaatcagccgggctccggatggcggcagctggtcaaccggacacgcggactattctgc
aacgagcgacacataccggcgcccaggaaacatttgctcaagaacgtttgcggcgtggcc
tatccgggcgaacttttggccgtgatgggcagttccggtgccggaaagacgaccctgctg
aatgcccttgcctttcgatcgccgcagggcatccaagtatcgccatccgggatgcgactg
ctcaatggccaacctgtggacgccaaggagatgcaggccaggtgcgcctatgtccagcag
gatgacctctttatcggctccctaacggccagggaacacctgattttccaagccatggtg
cggatgccacgacatctgacctatcggcagcgagtggcccgcgtggatcaggtgatccag
gagctttcgctcagcaaatgtcagcacacgatcatcggtgtgcccggcagggtgaaaggt
ctgtccggcggagaaaggaagcgtctggcattcgcctccgaggctctaaccgatccgccg
cttctgatctgcgatgagcccacctccggactggactcctttaccgcccacagcgtcgtc
caggtgctgaagaagctgtcgcagaagggcaagaccgtcatcctgaccattcatcagccg
tcttccgagctgtttgagctctttgacaagatccttctgatggccgagggcagggtagct
ttcttgggcactcccagcgaagccgtcgacttcttttcctacgtgggtgcccagtgtcct
accaactacaatccggcggacttttacgtacaggtgttggccgttgtgcccggacgggag
atcgagtcccgtgatcggatcgccaagatatgcgacaattttgccattagcaaagtagcc
cgggatatggagcagttgttggccaccaaaaatctggagaagccactggagcagccggag
aatgggtacacctacaaggccacctggttcatgcagttccgggcggtcctgtggcgatcc
tggctgtcggtgctcaaggaaccactcctcgtaaaagtgcgacttattcagacaacgatg
gttgccatcttgattggcctcatctttttgggccaacaactcacgcaagtgggtgtgatg
aatatcaacggagccatcttcctcttcctgaccaacatgacctttcaaaacgtctttgcc
acgataaatgtgttcacctcagagctgccagtttttatgagggaggcccgaagtcgactt
tatcgctgtgacacatactttctgggcaaaacgattgccgaattgccgctttttctcaca
gtgccactggtcttcacggcgattgcctatccgatgatcggactgcgggccggagtgctg
cacttcttcaactgcctggcgctggtcactctggtggccaatgtgtcaacgtccttcgga
tatctaatatcctgcgccagctcctcgacctcgatggcgctgtctgtgggtccgccggtt
atcataccattcctgctctttggcggcttcttcttgaactcgggctcggtgccagtatac
ctcaaatggttgtcgtacctctcatggttccgttacgccaacgagggtctgctgattaac
caatgggcggacgtggagccgggcgaaattagctgcacatcgtcgaacaccacgtgcccc
agttcgggcaaggtcatcctggagacgcttaacttctccgccgccgatctgccgctggac
tacgtgggtctggccattctcatcgtgagcttccgggtgctcgcatatctggctctaaga
cttcgggcccgacgcaaggagtag

DBGET integrated database retrieval system