KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2845Help
Entry
Dmel_CG2845       CDS       T00030                                 

Gene name
phl
Definition
pole hole (EC:2.7.11.-)
Orthology
K02644  
pole hole
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG2845 (phl)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG2845 (phl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:2F5-3A1; X:1-0.9 cM
AA seq 739 aa AA seqDB search
MSSESSTEGDSDLYDPLAEELHNVQLVKHVTRENIDALNAKFANLQEPPAMYLIEYQELT
SKLHELEAKEQELMERLNSQDQQEDSSLVERFKEQPHYQNQTQILQQQRQLARVHHGNDL
TDSLGSQPGSQCGTLTRQPKILLRAHLPNQQRTSVEVISGVRLCDALMKALKLRQLTPDM
CEVSTTHSGRHIIPWHTDIGTLHVEEIFVRLLDKFPIRTHIKHQIIRKTFFSLVFCEGCR
RLLFTGFYCSQCNFRFHQRCANRVPMLCQPFPMDSYYQLLLAENPDNGVGFPGRGTAVRF
NMSSRSRSRRCSSSGSSSSSKPPSSSSGNHRQGRPPRISQDDRSNSAPNVCINNIRSVTS
EVQRSLIMQARPPLPHPCTDHSNSTQASPTSTLKHNRPRARSADESNKNLLLRDAKSSEE
NWNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNEVAMLKKT
RHCNILLFMGCVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLH
AKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQ
ELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQA
LKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPKIHRSASEPNLTQSQLQNDEFLYLPS
PKTPVNFNNFQFFGSAGNI
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgagtcctccaccgaaggcgacagcgatctatacgatcctttggccgaggag
ctgcacaacgtccagttggtcaaacatgtgacccgcgagaatattgatgccctgaatgcc
aagtttgccaacctgcaggagccaccagccatgtacttaatagaataccaggagttgacc
tccaagctccacgaactggaggccaaggagcaggaactaatggagcgactgaactcgcag
gaccagcaggaggactcctccttggtcgagcggttcaaggagcagccccactatcaaaat
caaactcaaatcctgcagcaacaacggcaattggcgcgagtgcaccacggcaacgatcta
accgatagcttgggctctcagccgggcagccaatgtggaactttgacccgtcagcccaag
atccttttgcgagcccacctgcccaatcaacagcgcacttcagtggaggtaatttcggga
gtacgactatgtgatgccctcatgaaggccctgaaactccggcaactaacgccggatatg
tgcgaagtaagcacaactcattccggaagacatatcataccctggcacacggatatcggc
actctgcatgtggaggagatctttgtcaggctgctggataagtttcccattaggacacac
atcaagcaccagatcatacggaagaccttcttctcgttggtattctgcgagggctgtcga
aggcttctgttcaccgggttctactgtagccagtgtaattttcgattccatcagaggtgt
gccaatagagtgccgatgctgtgccagccctttcccatggatagctactatcagctactg
ctggccgagaatccggataatggcgttggtttccccggcagaggcactgctgtccgcttc
aatatgagcagccggagtcgcagtcgtcgttgcagcagcagtggcagcagcagcagctcg
aagccaccatcttcatcctccggcaatcatcgacagggtcgtccgccgaggatcagccaa
gacgatcgatccaattccgcgccaaatgtgtgcatcaacaacattcgatcggtcacaagc
gaagtgcagcgcagtttgataatgcaggccagacctcctttgccgcatccgtgcacagat
cactccaactccacgcaagcgtcgcccacgagcaccttgaaacacaatcgtcccagggcc
aggtccgccgatgagagcaataaaaatctgcttttaagagacgccaaaagttccgaggaa
aactggaatattctggcggaggagattttaattgggccgcgcatcggatcgggttccttt
ggaaccgtttatcgcgcccattggcacggtcccgtggccgtaaagacactcaacgtgaag
acaccgagtcccgcccagttgcaggcgtttaagaacgaggtggccatgctgaaaaagacg
cgccactgcaatatcctcctcttcatgggctgtgtatccaaaccatctctagcgattgtg
acccagtggtgcgagggcagcagtctctacaagcacgtccatgtcagcgaaaccaagttt
aaattgaacacgctcatcgatatcggacgtcaggtggcccagggcatggattacctgcat
gccaagaatatcattcatagagacctcaagtcaaacaacatctttttgcacgaggatctt
tccgtgaagataggcgacttcggattggccactgcgaaaactcgatggtcgggtgaaaag
caagccaatcaacccacgggcagtattttatggatggctccagaggtgattcgcatgcag
gagctaaacccctactccttccagtcggacgtttatgcctttggtatcgtgatgtacgaa
ctgttggcggagtgcttgccctacggtcatattagcaacaaggatcagatcctgtttatg
gtggggcgaggacttctgcgtccggacatgagtcaagtgcgctcggatgcgccgcaggca
ttgaagcgcttggccgaggattgcattaagtatacccccaaggatcgaccgctctttagg
ccgctgctcaatatgctggagaacatgctgcgcactttgcccaaaattcatcgcagtgcc
agtgaaccaaacttgacgcaatcgcagctgcagaacgatgagtttctgtatctgcccagc
ccgaaaacgccggtgaacttcaacaactttcagttcttcggcagcgctgggaatatctag

DBGET integrated database retrieval system