KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2845Help
Entry
Dmel_CG2845       CDS       T00030                                 

Gene name
Raf
Definition
(RefSeq) Raf oncogene (EC:2.7.11.-)
  KO
K04365  
B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Apoptosis - fly
Dorso-ventral axis formation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG2845 (Raf)
   04068 FoxO signaling pathway
    Dmel_CG2845 (Raf)
   04150 mTOR signaling pathway
    Dmel_CG2845 (Raf)
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG2845 (Raf)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG2845 (Raf)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG2845 (Raf)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: TKL group
  RAF family [OT]
   Dmel_CG2845 (Raf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:2F5-3A1; X:1-0.9 cM
AA seq 739 aa AA seqDB search
MSSESSTEGDSDLYDPLAEELHNVQLVKHVTRENIDALNAKFANLQEPPAMYLIEYQELT
SKLHELEAKEQELMERLNSQDQQEDSSLVERFKEQPHYQNQTQILQQQRQLARVHHGNDL
TDSLGSQPGSQCGTLTRQPKILLRAHLPNQQRTSVEVISGVRLCDALMKALKLRQLTPDM
CEVSTTHSGRHIIPWHTDIGTLHVEEIFVRLLDKFPIRTHIKHQIIRKTFFSLVFCEGCR
RLLFTGFYCSQCNFRFHQRCANRVPMLCQPFPMDSYYQLLLAENPDNGVGFPGRGTAVRF
NMSSRSRSRRCSSSGSSSSSKPPSSSSGNHRQGRPPRISQDDRSNSAPNVCINNIRSVTS
EVQRSLIMQARPPLPHPCTDHSNSTQASPTSTLKHNRPRARSADESNKNLLLRDAKSSEE
NWNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNEVAMLKKT
RHCNILLFMGCVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLH
AKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQ
ELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQA
LKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPKIHRSASEPNLTQSQLQNDEFLYLPS
PKTPVNFNNFQFFGSAGNI
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgagtcctccaccgaaggcgacagcgatctatacgatcctttggccgaggag
ctgcacaacgtccagttggtcaaacatgtgacccgcgagaatattgatgccctgaatgcc
aagtttgccaacctgcaggagccaccagccatgtacttaatagaataccaggagttgacc
tccaagctccacgaactggaggccaaggagcaggaactaatggagcgactgaactcgcag
gaccagcaggaggactcctccttggtcgagcggttcaaggagcagccccactatcaaaat
caaactcaaatcctgcagcaacaacggcaattggcgcgagtgcaccacggcaacgatcta
accgatagcttgggctctcagccgggcagccaatgtggaactttgacccgtcagcccaag
atccttttgcgagcccacctgcccaatcaacagcgcacttcagtggaggtaatttcggga
gtacgactatgtgatgccctcatgaaggccctgaaactccggcaactaacgccggatatg
tgcgaagtaagcacaactcattccggaagacatatcataccctggcacacggatatcggc
actctgcatgtggaggagatctttgtcaggctgctggataagtttcccattaggacacac
atcaagcaccagatcatacggaagaccttcttctcgttggtattctgcgagggctgtcga
aggcttctgttcaccgggttctactgtagccagtgtaattttcgattccatcagaggtgt
gccaatagagtgccgatgctgtgccagccctttcccatggatagctactatcagctactg
ctggccgagaatccggataatggcgttggtttccccggcagaggcactgctgtccgcttc
aatatgagcagccggagtcgcagtcgtcgttgcagcagcagtggcagcagcagcagctcg
aagccaccatcttcatcctccggcaatcatcgacagggtcgtccgccgaggatcagccaa
gacgatcgatccaattccgcgccaaatgtgtgcatcaacaacattcgatcggtcacaagc
gaagtgcagcgcagtttgataatgcaggccagacctcctttgccgcatccgtgcacagat
cactccaactccacgcaagcgtcgcccacgagcaccttgaaacacaatcgtcccagggcc
aggtccgccgatgagagcaataaaaatctgcttttaagagacgccaaaagttccgaggaa
aactggaatattctggcggaggagattttaattgggccgcgcatcggatcgggttccttt
ggaaccgtttatcgcgcccattggcacggtcccgtggccgtaaagacactcaacgtgaag
acaccgagtcccgcccagttgcaggcgtttaagaacgaggtggccatgctgaaaaagacg
cgccactgcaatatcctcctcttcatgggctgtgtatccaaaccatctctagcgattgtg
acccagtggtgcgagggcagcagtctctacaagcacgtccatgtcagcgaaaccaagttt
aaattgaacacgctcatcgatatcggacgtcaggtggcccagggcatggattacctgcat
gccaagaatatcattcatagagacctcaagtcaaacaacatctttttgcacgaggatctt
tccgtgaagataggcgacttcggattggccactgcgaaaactcgatggtcgggtgaaaag
caagccaatcaacccacgggcagtattttatggatggctccagaggtgattcgcatgcag
gagctaaacccctactccttccagtcggacgtttatgcctttggtatcgtgatgtacgaa
ctgttggcggagtgcttgccctacggtcatattagcaacaaggatcagatcctgtttatg
gtggggcgaggacttctgcgtccggacatgagtcaagtgcgctcggatgcgccgcaggca
ttgaagcgcttggccgaggattgcattaagtatacccccaaggatcgaccgctctttagg
ccgctgctcaatatgctggagaacatgctgcgcactttgcccaaaattcatcgcagtgcc
agtgaaccaaacttgacgcaatcgcagctgcagaacgatgagtttctgtatctgcccagc
ccgaaaacgccggtgaacttcaacaactttcagttcttcggcagcgctgggaatatctag

DBGET integrated database retrieval system