KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2846Help
Entry
Dmel_CG2846       CDS       T00030                                 

Definition
(RefSeq) CG2846, isoform B
  KO
K00861  
riboflavin kinase [EC:2.7.1.26]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dmel_CG2846
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Dmel_CG2846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 153 aa AA seqDB search
MLSQLPLFAGGEIVRGFGRGSKELGIPTANFPLEVVKSLPESLPTGAYYGWANVDNGPVH
KMVLSIGWNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSFDSLESLIAAI
RGDIEQAKAFLDEADKAKLKEAPFFTEKLCSSK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccaactgcctctgttcgctgggggcgagattgttcggggcttcggacgcggc
tccaaagagctgggcatcccaacagctaactttccgctggaggtggtgaaatcgctgccg
gaatccctgcccactggcgcgtactacggttgggcaaacgtggataatggacccgtgcac
aagatggtcctcagcatcggctggaatcccttctacaacaacaaggagaagagcgtggag
acgcacatgctacacgactttaactgtgacctttacggccagacactcaagatatgcatt
gtaggctacctgcgaccggagcgcagtttcgactccctggagtcactgattgccgccatc
cgcggggacatcgagcaggccaaggcgttcctcgacgaggcggacaaggccaagctgaag
gaggctccgttctttacggagaagctctgctcgtcgaaatag

DBGET integrated database retrieval system