KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2995Help
Entry
Dmel_CG2995       CDS       T00030                                 

Gene name
G9a
Definition
CG2995 gene product from transcript CG2995-RB (EC:2.1.1.43)
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG2995 (G9a)
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmel_CG2995 (G9a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:1A1-1A1
AA seq 1657 aa AA seqDB search
MTDFVELMNSMSSTFNSDCATSTAEGGTLLNLNLAEDKTLKWRNLANNQFASKEKKHKDK
EEEERKEARNQEEIEDIKALLADVVDAAAVKLEEEEAQNAEKVEPHTKCEIEEEGRKEME
YDQDVAKQDSEMEKKQNGKATSITVKMESNERAEKHATEIATTSTERWENESFKTEQQNK
KAAEKEEEPILAATQKLEANAEPLTTTRIEVAVASPLVVSSASVKLAADATNQMRAATSA
GAATLADKNVQVSPGGTRRSRRTPRPIDTPTSVTDEHVQVENKKFGKSEQYTDCSSHLER
FTLDDNTAIVRLQLKSEPDKPSLTALSPEENSAPAPKRGRGRARKIRPDAEVETSEVILP
CEDSLGEKKPGRKRKLPDEPIDQQQLSDLVVVKTEQEELGDAPLGDVKRMRRSVRLGNRL
HADGSPWEEVKTEALHPQPSAELSFAEVTSEILPLAVLDEKTPPKKRGRKAKTPCVKLES
ETSCGLPFANGNKKTNSSGGCELQLPKRSKRRIKPTPKILENDELRCEFETKHIERMTQW
ESAAAVDGDFETPTTGGNGSNSSTSRQKSDKSDGSNFEGGPGHPAGTSAIKKRLFSKSQR
DIENYGAAMLAKSKLPPCPDVEQFLNDIKASRINANRSPEERKLNKKQQRKLAKQKEKHL
KHLGLQKNHRDEPSDNDSSNTDNEFFPTTRVQVGKPSVTLRVRNSVTKELPTTATLKSRR
NPVVQAAKLTRRIGARAAGEVTEAARASVPISTPDAEQLHSLDTSIQADVTPIRDLDMRP
STSRVSKFICLCQKPSQYYARNAPDSSYCCAIDHIDDQKIGCCNELSSEVHNLLRPSQRV
SYMILCDEHKKRLQSHNCCAGCGIFCTQGKFVLCKQQHFFHPDCAQRFILSTSYEKELGD
EEDQGVKFSSPVLVLKCPHCGLDTPERTSTVTMKCQSLPVFLRTQKYKIKPARLTTSSHL
TQFGTVENANTPGATARNKGGLSTAVTLSAASSPASKTNGAQRGRAGTSNSNSRHALNSI
NFAQLIPESVMNVVLRGHVVSASGRVTAEFTPRDMYYAVQNDDLERVAEILAADFNVLTP
IREYLNGTCLHLVAHSGTLQMAYLLLCKGASSPDFVNIVDYELRTALMCAVMNEKCDMLN
LFLQCGADVAIKGPDGKTSLHIAAQLGNLEATQLIVDSYRTSRNITSFLSFIDAQDEGGW
TAMVWAAELGHTDIVRLASLPQAVFLKLINIFLFISFLLNQDADPNICDNDNNTVLHWST
LHNDGLDTITVLLQSGADCNVQNVEGDTPLHIACRHSVTRMCIALIANGADLMIKNKAEQ
LPFDCIPNEESECGRTVGFNMQMRSFRPLGLRTFVVCADASNGREARPIQVVRNELAMSE
NEDEADSLMWPDFRYVTQCIIQQNSVQIDRRVSQMRICSCLDSCSSDRCQCNGASSQNWY
TAESRLNADFNYEDPAVIFECNDVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVR
ALANVPKGTFVGSYTGEILTAMEADRRTDDSYYFDLDNGHCIDANYYGNVTRFFNHSCEP
NVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYGEKFWRVEHRSCVGCRCLTTTCK
YASQSSSTNASPTNATTAPENETGTLSSTNTEKIGHA
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgacggactttgttgagctgatgaacagcatgtccagtacattcaatagcgactgtgct
acttcaacagcggagggtggtactttgctaaatctgaacttggcggaagacaaaaccctc
aagtggcgtaatttggccaataaccagttcgctagtaaagaaaagaagcacaaggacaag
gaggaggaggagcgcaaggaggcaaggaatcaagaggaaatcgaagacatcaaagcactt
ttggcagatgttgtcgatgcggccgctgtcaagctggaagaagaagaagcgcagaatgca
gaaaaagtcgaaccacatacaaaatgcgaaatagaggaagaaggtaggaaggaaatggag
tacgatcaagatgtcgcaaaacaagactccgaaatggaaaaaaagcagaatggcaaagca
acatccataacagtaaagatggaaagcaacgagcgtgcagagaaacacgcaacggaaatt
gcaacgacgtcgacagagagatgggaaaacgaaagctttaaaactgagcagcaaaataaa
aaagctgctgagaaagaagaagaacccatactagcagcaacacaaaaattggaagcaaat
gcagaaccactgacaacaacaagaattgaggtagcagtagcatctccacttgttgttagt
tctgctagcgttaaactcgctgctgacgcaaccaaccaaatgcgagcagcgacgtcggca
ggagcagcgacattagctgataaaaatgtacaagtttcgcccggtggaacgcgacggtct
cgaagaacacccagacccatagacacgcccacttcagttactgatgaacatgttcaggtg
gagaataaaaaatttggaaagtcggagcagtatacggattgtagtagccatctggagagg
ttcacactggacgataatactgctattgtcagactgcagttgaaaagtgaaccggacaaa
ccgtcattaactgcattatctcctgaggaaaactcggctcctgctccgaagcgaggaagg
ggtcgagccaggaaaataagacccgatgccgaggtggaaaccagtgaggttattttaccc
tgcgaggattcattaggggagaagaaaccaggacgcaaaaggaaactcccggatgaaccg
atagatcagcagcaactaagcgaccttgtcgtggtaaaaacagagcaggaggaattgggt
gacgctcccttgggagatgttaagagaatgcgacgtagcgttcgtttaggcaatcgatta
cacgccgatggaagcccttgggaggaggtaaagacagaggcacttcacccgcagccttct
gcagaactttcctttgcggaggtcacttctgagatcttgccactagctgtcttagatgag
aagaccccacccaaaaagcgagggcggaaggcaaaaacgccctgtgtgaagttagaatct
gaaacatcctgcgggctaccgtttgctaatggcaacaagaaaacgaattcctctggtgga
tgcgaacttcagctgcccaagcgttcaaaaagaagaataaaaccaacgccaaagatatta
gaaaatgacgaactgcgctgtgagttcgaaacgaagcacattgagcgtatgacccagtgg
gagagtgctgcagcagtagatggggattttgaaacgccaacaacaggcggtaatgggtcc
aattcctcgacctcaaggcaaaagagcgacaagtccgacgggagcaacttcgaaggtggt
ccaggacatcctgcaggcacaagtgccataaagaaaagactattttcaaagtcccagcgg
gacattgagaactatggcgcagcaatgctagccaaaagtaagttacctccgtgtccggat
gtcgaacaatttctaaacgacatcaaggcatctcgaattaacgcgaatcggtcaccagaa
gaaaggaaattgaacaaaaaacagcaacgaaaactggccaaacaaaaggaaaagcacctg
aagcatttgggcctgcaaaaaaatcacagagatgagccctcggataacgacagttccaat
acggacaatgaattctttcctactacaagggtgcaagtgggaaaaccaagtgttactttg
agagtaaggaatagtgttaccaaggagcttcccaccacagccactttgaaatcacgccgg
aatccagtcgtgcaggcagccaaactcacgagaaggataggtgcaagagccgccggtgaa
gttactgaggcagcccgagcaagtgtgccaatttctacacctgatgcggagcagcttcac
tcgttggacacttctattcaagctgatgttacgcccataagagacttagatatgaggccc
agcacctccagagtgtcaaagtttatttgtctatgtcagaagccttcccagtattatgcc
aggaatgccccggattcatcatactgctgtgccatcgatcacatcgacgaccaaaaaatt
ggctgctgcaacgagctgtcctcagaggttcacaatctactcagacccagccaacgcgtt
agctatatgatcctatgcgatgagcacaaaaagcgcctacaatcacacaactgctgcgca
ggatgtggcatattttgtacacagggaaaatttgtgctatgcaagcagcagcacttcttt
catcccgattgtgcccagcgatttattctaagcacttcgtacgagaaggaactcggcgat
gaggaagatcagggcgtcaaattcagcagccctgtcttagtgcttaagtgcccccactgc
ggattagatacaccagaacggacctccacggtgaccatgaagtgtcagtccctgcctgtc
tttctgcgcacgcaaaagtacaagatcaaacccgctagattgacaacctcttcgcatcta
acccaatttggaacagttgagaatgccaataccccaggagccaccgccaggaacaaggga
ggactatccaccgccgtaaccttaagcgcggcatcaagtcctgcctcaaaaacaaatgga
gcccagagaggcagggcgggcacctccaattctaactccaggcatgctcttaattcgatc
aactttgctcaacttatacccgagtccgtaatgaatgtagtgctgcggggccacgtggtt
tctgctagcggtcgcgtgaccgcagagtttaccccgcgggatatgtactatgcagtccaa
aacgatgacttggagcgtgtagcggagattctggctgccgacttcaacgtgctgactccc
atacgggagtacttaaatggcacctgccttcatttggtggcccactcgggcacacttcag
atggcctatctccttctctgcaaaggagcaagctcaccggatttcgttaatattgtggat
tatgaactgcggactgctttaatgtgtgccgtgatgaacgagaagtgcgacatgctgaat
ctatttcttcaatgtggtgcggatgtggccattaagggtcccgatggtaagaccagtctg
catattgctgcccagttaggcaacttggaagccacacagttaattgtagacagctatcga
acttctcgaaatattaccagttttttaagtttcattgatgcccaggatgaaggcggttgg
acggccatggtctgggcagcagagctggggcacacggatatagttaggttggcttctctg
ccccaagcggttttcttaaagctaattaatatttttctcttcattagcttcctgcttaac
caggatgctgatccaaacatatgcgacaatgacaacaatacggtgctgcactggtctacg
ctgcacaatgatggtctggacacgattacagtactgctgcagtcaggggcggactgcaat
gtacagaatgtagagggcgacacgcctttgcacattgcttgccggcattctgtcacccgc
atgtgcatcgcgttaatagctaatggagccgatctaatgattaagaacaaggcggaacaa
ctgccctttgattgcattccgaatgaggagtctgagtgcggtcgcactgtaggttttaat
atgcaaatgcgtagtttcaggcctttgggcctccgtacctttgtggtttgtgcagatgcg
tcgaatggcagggaggcacgaccaatccaggtggttcgcaacgaactggcaatgtctgaa
aatgaggatgaggccgattcgcttatgtggccggattttcgctacgtaacacaatgcatt
atccagcagaattcagtgcagattgaccgacgcgtttctcaaatgcgcatctgctcctgc
ctggatagttgcagtagcgatcgctgtcagtgcaatggagcctcctcgcagaattggtac
acggcagaaagtcggctaaacgccgactttaactacgaggatcctgcggtaatcttcgaa
tgcaacgacgtctgcggttgcaaccagctgtcctgcaaaaaccgcgtggtgcagaatggt
acacggacacccctacaaattgtcgagtgcgaggatcaggcgaagggctggggagtacgg
gcgctggccaatgtacccaaaggcacttttgtgggcagttatacgggtgagattttgacc
gcgatggaggcagatcgacgcaccgatgacagctactactttgacctggacaacgggcac
tgcatcgatgccaactattatggaaatgtaacccggttttttaaccactcgtgtgagccg
aatgttttgcccgttcgtgttttctacgagcatcaggactacagattccctaagatcgcc
tttttttcctgccgtgacatcgatgccggagaggaaatatgctttgactacggagaaaaa
ttctggcgcgtggaacatcgctcctgtgttggatgtcgatgcctgacaacaacctgcaag
tacgcctcccaatcctcaagcacaaatgcctcgcctacgaatgcaacaacggcaccggaa
aatgaaacgggaacgctgtcgtctacaaatacggagaaaattggacacgcgtag

DBGET integrated database retrieval system