KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30092Help
Entry
Dmel_CG30092      CDS       T00030                                 

Gene name
jbug
Definition
(RefSeq) jitterbug, isoform G
  KO
K04437  filamin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dmel_CG30092 (jbug)
  Intermediate filaments
   Intermediate filament-binding proteins
    Dmel_CG30092 (jbug)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG30092 (jbug)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin Big_3_5 Big_1
Motif
Other DBs
NCBI-GeneID: 43997
NCBI-ProteinID: NP_001163256
FlyBase: FBgn0028371
UniProt: Q8MME5
Position
2R
AA seq 410 aa AA seqDB search
MSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARVTHEAA
NGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQACQFRV
DASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETVRGCPFV
CAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQGELPVRVTGDIHA
GFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRPVQFTVDA
GDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMPVPGCPIT
VSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGRRNLLY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacccggcctaaccgctctgggcgaatccacgcgcctggtacccgccaatacg
ccggcggtttttgagatactgccgcctcctggacaaagcctgagtaagggcgagtgcgtg
gcgacagttttgactcctagcaagtcaaagctgaacgccagagtcacccacgaggcggca
aatggtgctgctcgcatcgagttcgtgcccaccgaggtgggcacccacgtgatcgatgcg
tccattaacggcacgaagatcgctggcggcccgctgatcgccaaggtctacgactccagc
ctgatccaggtgacggaggtgaatggcggcgtggtcggccaggcgtgccagttccgcgta
gatgccagcgccgccggcgagggccagctggagatatccatcaacgagggcgaggtgccc
aatcatgtccaggtggtgggcggtggtcgctgcctggtctccttcacgccggagcaggcc
aagtcgcatctgattgacatcaaattcaatggcgaaacggtgcgcggctgtccctttgtc
tgcgccgtggcggacacctcgcgagtgctcctgaatctctccaatctggagctaatccca
gtcaaccggccctcctcctttcacatcaccgtgagcggaggtggagctgccgagctggct
gtcagcgtgcgcggtccccagggcgagttgcctgtccgggtgaccggagatatccacgct
ggcttcacggccgagtttacgcccaccaccgttggcggccactcgatcaatgtggagtac
aacggattcgccgtgcagggaacccccttcctggccaagtcatacgatgccagcaaggtg
gtggtgggcagtgtctcgcggggaaccatgggacgcccggtgcagttcaccgtggatgcg
ggcgatgccggtgagggcaacctggagataacgatttcggccaagggacagaacattccc
acgcaggtgcatccgcaaggcagtgcaagattttcggtttcgtttgtgcccacagagtcg
tgcgagcacacgatcaacgtgtcattcaacaaaatgcccgttcccggctgtccgattacg
gttagcatcagtgggggcgtggccgggccccaggtgtccctgggtggcccaggacccgtg
catcagaccaattcttttgtaatcaatcacaatggcggccgtttggaagacatcgaggtg
aacgtggaaggacggcgaaatcttttgtactag

DBGET integrated database retrieval system