KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30092Help
Entry
Dmel_CG30092      CDS       T00030                                 

Gene name
jbug
Definition
jitterbug
Orthology
K04437  
filamin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG30092 (jbug)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:59A3-59A3
AA seq 410 aa AA seqDB search
MSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARVTHEAA
NGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQACQFRV
DASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETVRGCPFV
CAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQGELPVRVTGDIHA
GFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRPVQFTVDA
GDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMPVPGCPIT
VSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGRRNLLY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacccggcctaaccgctctgggcgaatccacgcgcctggtacccgccaatacg
ccggcggtttttgagatactgccgcctcctggacaaagcctgagtaagggcgagtgcgtg
gcgacagttttgactcctagcaagtcaaagctgaacgccagagtcacccacgaggcggca
aatggtgctgctcgcatcgagttcgtgcccaccgaggtgggcacccacgtgatcgatgcg
tccattaacggcacgaagatcgctggcggcccgctgatcgccaaggtctacgactccagc
ctgatccaggtgacggaggtgaatggcggcgtggtcggccaggcgtgccagttccgcgta
gatgccagcgccgccggcgagggccagctggagatatccatcaacgagggcgaggtgccc
aatcatgtccaggtggtgggcggtggtcgctgcctggtctccttcacgccggagcaggcc
aagtcgcatctgattgacatcaaattcaatggcgaaacggtgcgcggctgtccctttgtc
tgcgccgtggcggacacctcgcgagtgctcctgaatctctccaatctggagctaatccca
gtcaaccggccctcctcctttcacatcaccgtgagcggaggtggagctgccgagctggct
gtcagcgtgcgcggtccccagggcgagttgcctgtccgggtgaccggagatatccacgct
ggcttcacggccgagtttacgcccaccaccgttggcggccactcgatcaatgtggagtac
aacggattcgccgtgcagggaacccccttcctggccaagtcatacgatgccagcaaggtg
gtggtgggcagtgtctcgcggggaaccatgggacgcccggtgcagttcaccgtggatgcg
ggcgatgccggtgagggcaacctggagataacgatttcggccaagggacagaacattccc
acgcaggtgcatccgcaaggcagtgcaagattttcggtttcgtttgtgcccacagagtcg
tgcgagcacacgatcaacgtgtcattcaacaaaatgcccgttcccggctgtccgattacg
gttagcatcagtgggggcgtggccgggccccaggtgtccctgggtggcccaggacccgtg
catcagaccaattcttttgtaatcaatcacaatggcggccgtttggaagacatcgaggtg
aacgtggaaggacggcgaaatcttttgtactag

DBGET integrated database retrieval system