KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3016Help
Entry
Dmel_CG3016       CDS       T00030                                 

Gene name
Usp30
Definition
(RefSeq) ubiquitin specific protease 30, isoform B
  KO
K11851  ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG3016 (Usp30)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG3016 (Usp30)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG3016 (Usp30)
Membrane trafficking [BR:dme04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dmel_CG3016 (Usp30)
Ubiquitin system [BR:dme04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmel_CG3016 (Usp30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zinc_ribbon_6
Motif
Other DBs
NCBI-GeneID: 31519
NCBI-ProteinID: NP_001284912
FlyBase: FBgn0029819
UniProt: Q9W462
Position
X
AA seq 558 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNFGLTCFLNTLLQAMAAC
PQFIAWLQLYNNASPDRKSLITSMLNTLEVVNGTHATLRGDPYSPGAVLRALNALGWVIP
QEEHDAHELFHVLLTCLEEEAIRPQPLGCLSDALPTDNDDNSSLAGTATPVGGFRSFSSM
AAGLGASQRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRSEAHTPDSPASVCERDGND
RLGSVLLDAVSPGTPFGFPLVSNPDSLATPMLGGERSSRPRLPQSQQQQDEGLNRRVSSS
CRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNL
PPQRRTGLSLGHLLSEYITSEDLSDVKCDSCNETTTHTKSVTFAKLPACLCIHVARTVWL
PTGQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEG
FGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWYYTSDTIVREVSIDEVLSV
PAYLLFYDRGQQRQLNLR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgagaagattctaatggccgccggagtgacggtagccgccgtagtcggagcc
ttcgttttctggggtccttcgggttcccgtttgcgtcaacgacgcggccaaattgccggt
ctccacaactttggactgacctgcttcctaaacaccctgctacaggcgatggccgcctgt
ccccagttcattgcctggctgcaattgtacaacaacgcctcgccggatcgaaaaagctta
attacgtcgatgttaaacactctggaagtggtcaatggcacccatgccactctgcgcggc
gatccctattcaccgggagccgttctccgggctctgaatgccctgggctgggtgattcca
caggaggagcacgacgcccacgagctgttccacgtgctattgacctgcctggaggaggag
gccatacgaccacagcccctcggctgtctgtcggatgctctgcccacggataacgatgat
aacagcagcttggcaggcacagcaacgccagtagggggctttcgatcatttagctccatg
gcagcgggactgggagccagccagaggatcggggatcaaccgaaccggccctccagtgcc
atgctcactgatttcttaaacatggagtatgatgagagcaccagtttgcagcgattggtg
cgttccgaggcccacacaccggattcgcctgcctctgtttgcgaacgcgacggaaacgat
cgcctgggatccgtgcttctggatgccgtttcgccagggacaccctttggctttccgctc
gtcagcaatccggattccttggctacgcctatgttgggcggcgagcgttcgtcgcgaccg
cgacttccacaatcccaacagcagcaggatgagggtctgaatcgccgggtgtccagctcc
tgtcgatcgctagagcgcctgcatcgcggaccaggtcgggtgtccatctggtccaacatg
atgcccagccaagtggcgcatccgtttcagggcgccatgggcgcacagatcgtgtgcaat
ggctgcggctccaagtcggccgttcggtacgataagttcgacagcataacgctaaatctg
ccgccgcaacgcagaactggcttgagtttgggccacttgcttagcgagtatatcacatcg
gaggatctgagcgatgtcaagtgtgactcctgcaacgagaccaccacgcacaccaaatcg
gttacgttcgctaaactaccggcctgcctgtgcatccatgtggcgcggacggtgtggctg
ccaactggacaggtgtgcaagcggaaggactatgtacacttccccgagagcctctccatg
gcgccctacagcttcgtgcagccgcatctcaatagccaggctggcactccctggggctcg
acaatgtcgctgtattcctccagcctgccgatgaacaatggcgttggtggtggcgagggc
tttggcacgatgttccccaagaatctttaccggcttctggccgtggtggtgcactccggg
gaggcaaacagcggtcactttgtaacctacaggcgtggctcgttgcggaacgcacatcgg
tggtactacacatcggatacaattgtgcgggaggtgagcatcgacgaggtgttgagcgtc
cccgcctatcttttattctacgatcgtggccagcagaggcagctaaatctgcgctag

DBGET integrated database retrieval system