KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3016Help
Entry
Dmel_CG3016       CDS       T00030                                 

Definition
CG3016 gene product from transcript CG3016-RA
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG3016
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG3016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:5C5-5C6
AA seq 558 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNFGLTCFLNTLLQAMAAC
PQFIAWLQLYNNASPDRKSLITSMLNTLEVVNGTHATLRGDPYSPGAVLRALNALGWVIP
QEEHDAHELFHVLLTCLEEEAIRPQPLGCLSDALPTDNDDNSSLAGTATPVGGFRSFSSM
AAGLGASQRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRSEAHTPDSPASVCERDGND
RLGSVLLDAVSPGTPFGFPLVSNPDSLATPMLGGERSSRPRLPQSQQQQDEGLNRRVSSS
CRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNL
PPQRRTGLSLGHLLSEYITSEDLSDVKCDSCNETTTHTKSVTFAKLPACLCIHVARTVWL
PTGQVCKRKDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEG
FGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWYYTSDTIVREVSIDEVLSV
PAYLLFYDRGQQRQLNLR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgagaagattctaatggccgccggagtgacggtagccgccgtagtcggagcc
ttcgttttctggggtccttcgggttcccgtttgcgtcaacgacgcggccaaattgccggt
ctccacaactttggactgacctgcttcctaaacaccctgctacaggcgatggccgcctgt
ccccagttcattgcctggctgcaattgtacaacaacgcctcgccggatcgaaaaagctta
attacgtcgatgttaaacactctggaagtggtcaatggcacccatgccactctgcgcggc
gatccctattcaccgggagccgttctccgggctctgaatgccctgggctgggtgattcca
caggaggagcacgacgcccacgagctgttccacgtgctattgacctgcctggaggaggag
gccatacgaccacagcccctcggctgtctgtcggatgctctgcccacggataacgatgat
aacagcagcttggcaggcacagcaacgccagtagggggctttcgatcatttagctccatg
gcagcgggactgggagccagccagaggatcggggatcaaccgaaccggccctccagtgcc
atgctcactgatttcttaaacatggagtatgatgagagcaccagtttgcagcgattggtg
cgttccgaggcccacacaccggattcgcctgcctctgtttgcgaacgcgacggaaacgat
cgcctgggatccgtgcttctggatgccgtttcgccagggacaccctttggctttccgctc
gtcagcaatccggattccttggctacgcctatgttgggcggcgagcgttcgtcgcgaccg
cgacttccacaatcccaacagcagcaggatgagggtctgaatcgccgggtgtccagctcc
tgtcgatcgctagagcgcctgcatcgcggaccaggtcgggtgtccatctggtccaacatg
atgcccagccaagtggcgcatccgtttcagggcgccatgggcgcacagatcgtgtgcaat
ggctgcggctccaagtcggccgttcggtacgataagttcgacagcataacgctaaatctg
ccgccgcaacgcagaactggcttgagtttgggccacttgcttagcgagtatatcacatcg
gaggatctgagcgatgtcaagtgtgactcctgcaacgagaccaccacgcacaccaaatcg
gttacgttcgctaaactaccggcctgcctgtgcatccatgtggcgcggacggtgtggctg
ccaactggacaggtgtgcaagcggaaggactatgtacacttccccgagagcctctccatg
gcgccctacagcttcgtgcagccgcatctcaatagccaggctggcactccctggggctcg
acaatgtcgctgtattcctccagcctgccgatgaacaatggcgttggtggtggcgagggc
tttggcacgatgttccccaagaatctttaccggcttctggccgtggtggtgcactccggg
gaggcaaacagcggtcactttgtaacctacaggcgtggctcgttgcggaacgcacatcgg
tggtactacacatcggatacaattgtgcgggaggtgagcatcgacgaggtgttgagcgtc
cccgcctatcttttattctacgatcgtggccagcagaggcagctaaatctgcgctag

DBGET integrated database retrieval system