KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3025Help
Entry
Dmel_CG3025       CDS       T00030                                 

Gene name
mof
Definition
males absent on the first (EC:2.3.1.32 2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG3025 (mof)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:5C5-5C5
AA seq 827 aa AA seqDB search
MSEAELEQTPSAGHVQEQPIEEEHEPEQEPTDAYTIGGPPRTPVEDAAAELSASLDVSGS
DQSAEQSLDLSGVQAEAAAESEPPAKRQHRDISPISEDSTPASSTSTSSTRSSSSSRYDD
VSEAEEAPPEPEPEQPQQQQQEEKKEDGQDQVKSPGPVELEAQEPAQPQKQKEVVDQEIE
TEDEPSSDTVICVADINPYGSGSNIDDFVMDPDAPPNAIITEVVTIPAPLHLKGTQQLGL
PLAAPPPPPPPPAAEQVPETPASPTDDGEEPPAVYLSPYIRSRYMQESTPGLPTRLAPRD
PRQRNMPPPAVVLPIQTVLSANVEAISDDSSETSSSDDDEEEEEDEDDALTMEHDNTSRE
TVITTGDPLMQKIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLN
RRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRA
ANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAALEKEHESITKI
KYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPP
GREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGS
HIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDL
GRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNV
ICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQTAAAVVRAPGNSG
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcggagctggaacagacacccagcgcgggccacgtgcaggagcagccgatt
gaggaggagcatgagccggaacaggagccaaccgatgcgtacacaattggcggtccgccg
aggacgccggttgaagatgcggcggccgaattgagcgccagtctagacgtcagcggctcg
gatcagtcggcggagcagtcgctcgacctcagcggtgtccaagcggaggccgcggcggag
tcagagccaccggcgaagcgccagcatcgcgacatcagtcccatttcggaggacagcacg
ccggcgagcagcacatcgactagttccaccaggtcgtccagctcctcccgctacgacgat
gttagcgaggcggaggaggcaccaccggagcccgagccggagcaaccacagcagcagcag
caggaggaaaagaaggaggacggtcaggatcaggtgaagtcaccaggtccagttgaattg
gaggcacaggagcccgcgcagccgcagaagcagaaagaggtggtggaccaggaaattgaa
accgaggatgagccctcctccgatacggtaatctgcgtggccgacatcaacccctacggc
agtggttccaacattgacgacttcgttatggatcccgatgctcctcccaatgcaataatc
accgaggtggttaccattccagctcctcttcatctcaaagggacacaacaactggggctg
ccattggctgccccaccgccaccaccacctcctccagcagcggaacaagtccccgagact
cccgcctcgcccacagatgacggcgaggaaccaccagcagtatatttatccccctacata
cgctctcgctacatgcaggaatcgacacctggcctgcccacccgcctggcgccgcgtgat
cctcgccagcgcaacatgccgccgccagccgtagttctgcccattcaaaccgtacttagc
gccaacgttgaggccatttctgacgacagcagcgaaactagcagcagcgatgacgatgaa
gaggaagaggaggacgaagatgatgccttgaccatggagcacgacaacacttccagggag
acggtcatcacaacaggtgaccctctgatgcaaaagatcgatataagcgaaaatcccgac
aagatctattttattcggcgcgaggatggcaccgtgcaccgtggccaggtgcttcagtct
cgcaccactgagaatgcggccgctcccgatgagtactacgtccactatgttggtctcaat
cgccgcctggacggatgggtgggcaggcataggatctcggacaatgcggatgacttgggc
ggtattaccgtgctgccagcgccaccattagcccccgatcagccaagtactagcagggaa
atgctcgcccaacaggccgccgcggcggcagctgcctcatccgaacggcagaagcgtgcg
gccaacaaggattactatctgtcctattgcgagaacagtcgctatgactacagcgaccgc
aagatgacacgctaccagaagcggcgctacgatgagatcaaccacgtgcagaagagccac
gctgagctgaccgccacgcaggcggcgctggagaaggagcacgagtccattacgaagatc
aagtacattgataagctgcagtttggcaactacgagatcgacacctggtactttagtccc
ttccccgaagaatatggcaaggcacgtacgttatatgtttgcgagtactgcctaaagtac
atgcgcttcaggtcgagctatgcctatcatctgcacgaatgcgaccgcaggcgtccgccc
ggaagagagatctaccgcaagggcaatatatccatttacgaggtgaacggcaaggaggag
tcactatactgccaacttttgtgtctgatggccaagctctttttggaccacaaggttcta
tacttcgacatggacccgtttctcttttacatcctttgcgagacggacaaggagggcagt
cacattgtgggctatttctccaaggaaaagaagtcgctggaaaactacaacgtggcctgc
attctggtattgccgccgcatcagcgtaagggatttggaaagctactaatagcctttagc
tatgagctgtcgcgcaaggagggcgtaatcggtagtccggagaaaccgctctcggatctg
ggtaggctgagctatcgcagctattgggcatacacgctgctggagctgatgaaaacccgc
tgcgctccagagcagatcacaatcaaggagctgagcgaaatgagtggcatcacccacgac
gacattatctacacgctgcagtccatgaagatgatcaagtattggaagggccagaatgtc
atttgcgttacgtccaagaccattcaagaccacctccagctgccgcagttcaagcagccc
aagctgaccatcgacaccgattacctcgtctggagtccgcaaactgcagcggcagtggtc
agagctccgggaaattccggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system