KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30421Help
Entry
Dmel_CG30421      CDS       T00030                                 

Definition
CG30421 gene product from transcript CG30421-RA (EC:3.1.2.15)
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:60D16-60E1
AA seq 1272 aa AA seqDB search
MGTTKERREQSEGDAATTHLTTTATATTGAIVAAGVTTTLPATKTTTTAADTSTTNAAKK
IRRTFSMPRNPFRWTRKFKTAVAVTSSAGAENDNESGKNNGARERRGSHTAISSCVGGGR
GRSGSIVSLSSYEAPFISSTNNNTTTASNGNNNNSSSSNINSKRTRALRRSSFRKFLNRI
AQHLSSTVNVVSEEKHSPANRIAFIEIVPFYTGCWRRKEANKHGQPSVSGSSSGGGGGAG
GPGGGERVPPIGGYQWPADQTPGVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKA
DLKRRNKINSRKFGTKGELTEQLANVLKALWTCKNESDHSTSFKAVVDRYGTQFRSSTQH
DAQEFLFWLLDKVHEDLNTASKRRYKSLKNSYGRSDEVIAAETLANHIRCNNSFVQAVFQ
AQFRSSLTCPRCEKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMTRLPRQVRMGLRVPAG
SPIVALREQLQADTGIEGSRMVLVDLNAEGFTRVFYDTQPVETLSSIETIYCIEVPAATP
VAKAATPSETGDKSAPTAVTPSPAAAQSQADLLLLVANVYRAKDGADITRFGAPFSMKAP
RDCSYQDLQKRMLREMAPLLKPEVFSYATPLAEMFRIRLQDPSADPDTYLEQVEHPLLTE
MIDMALSVLSSEAGPQHIKLLLEWSSPEAHFISKQQDTEEAVVEHESVARLSASKPSDTA
ALTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSK
GPQAAKLTTMVKFPLTAFDMSPHLARGVHESASSSLGMGTGIGLGLGLGSNPWKKARSVD
SRSSTLNSRCDAKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPE
DDIEQDIINNEAYMLFYQRRSVDAGECSGSSSNSGDHWVSRIAPASSSSASSTSGKEREP
VKLEENTESPAAVEVTEKAQSKPVDIVCQDKAKGTADGPDADQEQTTVPHDLQIEELAFA
DADVDTSLGETIKAEVNLAAKDEPKKVEVEEATPIFAMDEDGSEARQEKKEECVKKEDEL
SEAPDVSELTAESKTNGHVSSSSSSSSSESSLSSRSSPRSLSTSVTAASTLQSKFNGHMS
AAPALFNGNGNTSQLSSSLQLSRHVLHNHQWHGSRSSVSAVENATQHQQQQAAASLSLRH
SFSTSSNYTETLSSLLRKSANTCSKDTLLFIDQQSHHHTAGLIEDDDDSYMGRSLWISPV
TPHKLITVSPKN
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaacaaaggagcgaagagagcaaagcgagggcgacgccgccaccacccactta
acaacaacagcaacagcaacaacaggagcaatagtagcagcaggagttactactacgctg
ccagctacaaaaacaacaaccacagcggcagacacgagcacgacgaatgccgccaaaaag
attcgccgcaccttctccatgccacgcaatcccttccgctggacgcgtaagttcaaaacg
gcagtggccgttacgtcgtccgcgggagcggaaaacgataacgaaagcggcaagaataac
ggggccagggagcggcgtggcagccacacggcgatctcgtcctgcgtgggaggtgggcgt
ggcaggagcgggagcattgtgtcgctcagcagctacgaggccccattcatttcgtccacc
aacaacaacacaaccaccgccagcaatggaaacaacaacaacagtagcagtagcaacatc
aacagcaagcggacacgtgctctgcgccgttcgtccttcaggaagtttctcaaccggatc
gcccagcacctgagctcaacggttaatgtcgtgtcggaggagaagcactcgcctgcgaat
cgcatcgccttcattgaaattgtgccattctacaccggatgctggcgcagaaaagaggcg
aacaaacatggtcagccatcggtttcgggctcttcgtcgggcggcggaggaggagcagga
ggaccaggcggcggggagagagtgccccccatcggaggctatcagtggccggcggatcag
actccaggtgtaatgggattgaagaaccacgggaacacttgctttatgaacgcggtgctg
caatgcctcagtcacacagacatactggccgagtactttgttttagatcagtacaaggct
gacctcaagcgacgcaacaagattaactcgcgaaagttcggcactaagggagagctcacc
gagcagctggccaacgtgctgaaggcgctgtggacttgcaagaacgagagtgatcacagc
accagctttaaggcagtggtagatcggtacggaacgcagttccgcagctcgacgcaacac
gatgcccaggagtttcttttttggttgcttgacaaggtgcacgaggacctcaacacagcc
agcaagcggcgctacaagagcctcaagaactcgtacggccgttcggacgaggtgatcgcc
gccgagacgctggccaatcacatccggtgcaacaacagcttcgtccaggccgtgttccag
gcccagtttcgctcatcgcttacctgcccgcgctgcgaaaagcagtcaaacacattcgac
ccctttcactgcatctccgtgcagctgccgcagctcacgcagcagacgatatttgtcact
gtagtctacatgacgcggctcccacgtcaggtgcggatgggcctgcgagttccagccgga
tcgccaatagtagcgcttcgagagcagcttcaggcggacacgggtatcgagggatcgcga
atggtcctggtggacttaaacgccgaaggattcacccgcgttttttacgacacgcaaccc
gtagagacgctatctagcattgaaacaatttactgcatcgaggtgccggcggcaactcct
gttgccaaggctgctactccttcagagacgggggataagtctgctccaacagcagtgact
ccatctcctgctgcagctcaatcgcaggcggacctgttgctcctagtggccaacgtatac
cgagcgaaggatggcgcggatataacccgctttggagcccccttcagcatgaaggcacct
cgtgactgctcataccaggatctgcagaaacgaatgctccgcgaaatggcgccgctgctc
aagccagaggtgttctcctatgccaccccactggccgagatgttccgtattcggctgcaa
gacccatccgcagaccctgatacctatttggagcaagtggagcacccgttgcttaccgaa
atgatcgacatggcgctttccgtgctttcctccgaggcaggaccccagcatataaagctc
cttttggagtggagttcacccgaggcacactttatcagtaaacagcaggacacggaagaa
gccgtcgtggagcacgagagcgttgctcgtctaagtgccagcaagccgagcgacaccgct
gcgctgactttggagcagtgcctggagcactataccaaggcagagactctgagtgccgag
gatgcctggcgctgtccacactgccagcaataccttccagttgtgaagacgctgggtctg
tggtcgctgcccgacatcctagtagtgcatttcaagcgcttccggcaacatcaatctaaa
ggtccgcaagcggctaagctgacaacaatggtcaagtttccgctgaccgccttcgacatg
tcaccgcacttggcacgtggcgtgcatgaaagcgccagcagctcgctgggtatgggaacg
ggcattggacttggactcgggctgggctcgaatccctggaagaaagctcgttccgtcgac
tcgcggtcctccacacttaactcgcgctgtgacgcaaaggatacgcggtacgacctttac
gcagtgtgctaccatcagggagatacattggaaacagggcattatacagctgcctgcaag
aatccttacgaccgtcagtggtataagttcgacgaccagcgagtgagcaaggtgcctgag
gacgacattgagcaggacataatcaataatgaggcatacatgctcttctaccagcgacgc
agtgtagatgcaggcgagtgttccggttccagttcgaactccggagatcactgggtatcg
cgaattgcgccagcctcatcatcgtccgcatcatcgacgtcaggaaaggagagggagccg
gttaagttggaggaaaacacagaatctcctgcggcagtagaagtaacggagaaggctcag
tccaagccggtggacatagtttgccaggataaggcgaaaggtactgcagacggcccagac
gctgatcaagaacagacaactgttccacatgatttacaaattgaggaactggcattcgcg
gatgcagatgtagacaccagtttaggagagaccatcaaggcggaggtaaatctagcggct
aaggatgaacccaaaaaggtggaggtagaggaagccacgcctatatttgccatggatgaa
gacggttccgaagctagacaggagaagaaggaggaatgcgttaagaaggaagacgaactc
tccgaagccccagatgtgagcgaactaaccgccgagtccaagaccaatggccacgtgagc
tcttcgtccagctcttcctcctcggaaagctcgctatcgtcccgctcctcgccgcgatca
ttgagtacttcagtcacagctgcatctactctgcagagcaagttcaacggccacatgagc
gccgctccagctcttttcaatggaaatggaaatacgtcacagctctcgtccagcttgcaa
ctatcccggcatgtgctgcacaaccatcaatggcacggatctaggagcagcgtgtcagct
gtagagaatgctacgcaacatcaacagcagcaggcggcggccagtctgagccttcgtcat
tcgttttccacaagttcaaattacacggagacactatcatccttgctacgcaaatcagca
aatacatgcagcaaggacacgctgctgtttatcgaccaacagagtcaccatcatacagcc
ggactgatcgaagatgacgatgattcatacatgggcaggtccctttggatatcgcccgta
acgccacacaaactcatcactgtttcgcccaagaattag

DBGET integrated database retrieval system