KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30421Help
Entry
Dmel_CG30421      CDS       T00030                                 

Definition
CG30421 gene product from transcript CG30421-RA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG30421
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG30421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:60D16-60E1
AA seq 1244 aa AA seqDB search
MGTTKERREQSEGDAATTHLTTTATATTGAIVAAGVTTTLPATKTTTTAADTSTTNAAKK
IRRTFSMPRNPFRWTRKFKTAVAVTSSAGAENDNESGKNNGARERRGSHTAISSCVGGGR
GRSGSIVSLSSYEAPFISSTNNNTTTASNGNNNNSSSSNINSKRTRALRRSSFRKFLNRI
AQHLSSTVNVVANKHGQPSVSGSSSGGGGGAGGPGGGERVPPIGGYQWPADQTPGVMGLK
NHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLANVLK
ALWTCKNESDHSTSFKAVVDRYGTQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRRYKSL
KNSYGRSDEVIAAETLANHIRCNNSFVQAVFQAQFRSSLTCPRCEKQSNTFDPFHCISVQ
LPQLTQQTIFVTVVYMTRLPRQVRMGLRVPAGSPIVALREQLQADTGIEGSRMVLVDLNA
EGFTRVFYDTQPVETLSSIETIYCIEVPAATPVAKAATPSETGDKSAPTAVTPSPAAAQS
QADLLLLVANVYRAKDGADITRFGAPFSMKAPRDCSYQDLQKRMLREMAPLLKPEVFSYA
TPLAEMFRIRLQDPSADPDTYLEQVEHPLLTEMIDMALSVLSSEAGPQHIKLLLEWSSPE
AHFISKQQDTEEAVVEHESVARLSASKPSDTAALTLEQCLEHYTKAETLSAEDAWRCPHC
QQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQAAKLTTMVKFPLTAFDMSPHLARGV
HESASSSLGMGTGIGLGLGLGSNPWKKARSVDSRSSTLNSRCDAKDTRYDLYAVCYHQGD
TLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDDIEQDIINNEAYMLFYQRRSVDAGECS
GSSSNSGDHWVSRIAPASSSSASSTSGKEREPVKLEENTESPAAVEVTEKAQSKPVDIVC
QDKAKGTADGPDADQEQTTVPHDLQIEELAFADADVDTSLGETIKAEVNLAAKDEPKKVE
VEEATPIFAMDEDGSEARQEKKEECVKKEDELSEAPDVSELTAESKTNGHVSSSSSSSSS
ESSLSSRSSPRSLSTSVTAASTLQSKFNGHMSAAPALFNGNGNTSQLSSSLQLSRHVLHN
HQWHGSRSSVSAVENATQHQQQQAAASLSLRHSFSTSSNYTETLSSLLRKSANTCSKDTL
LFIDQQSHHHTAGLIEDDDDSYMGRSLWISPVTPHKLITVSPKN
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaacaaaggagcgaagagagcaaagcgagggcgacgccgccaccacccactta
acaacaacagcaacagcaacaacaggagcaatagtagcagcaggagttactactacgctg
ccagctacaaaaacaacaaccacagcggcagacacgagcacgacgaatgccgccaaaaag
attcgccgcaccttctccatgccacgcaatcccttccgctggacgcgtaagttcaaaacg
gcagtggccgttacgtcgtccgcgggagcggaaaacgataacgaaagcggcaagaataac
ggggccagggagcggcgtggcagccacacggcgatctcgtcctgcgtgggaggtgggcgt
ggcaggagcgggagcattgtgtcgctcagcagctacgaggccccattcatttcgtccacc
aacaacaacacaaccaccgccagcaatggaaacaacaacaacagtagcagtagcaacatc
aacagcaagcggacacgtgctctgcgccgttcgtccttcaggaagtttctcaaccggatc
gcccagcacctgagctcaacggttaatgtcgtggcgaacaaacatggtcagccatcggtt
tcgggctcttcgtcgggcggcggaggaggagcaggaggaccaggcggcggggagagagtg
ccccccatcggaggctatcagtggccggcggatcagactccaggtgtaatgggattgaag
aaccacgggaacacttgctttatgaacgcggtgctgcaatgcctcagtcacacagacata
ctggccgagtactttgttttagatcagtacaaggctgacctcaagcgacgcaacaagatt
aactcgcgaaagttcggcactaagggagagctcaccgagcagctggccaacgtgctgaag
gcgctgtggacttgcaagaacgagagtgatcacagcaccagctttaaggcagtggtagat
cggtacggaacgcagttccgcagctcgacgcaacacgatgcccaggagtttcttttttgg
ttgcttgacaaggtgcacgaggacctcaacacagccagcaagcggcgctacaagagcctc
aagaactcgtacggccgttcggacgaggtgatcgccgccgagacgctggccaatcacatc
cggtgcaacaacagcttcgtccaggccgtgttccaggcccagtttcgctcatcgcttacc
tgcccgcgctgcgaaaagcagtcaaacacattcgacccctttcactgcatctccgtgcag
ctgccgcagctcacgcagcagacgatatttgtcactgtagtctacatgacgcggctccca
cgtcaggtgcggatgggcctgcgagttccagccggatcgccaatagtagcgcttcgagag
cagcttcaggcggacacgggtatcgagggatcgcgaatggtcctggtggacttaaacgcc
gaaggattcacccgcgttttttacgacacgcaacccgtagagacgctatctagcattgaa
acaatttactgcatcgaggtgccggcggcaactcctgttgccaaggctgctactccttca
gagacgggggataagtctgctccaacagcagtgactccatctcctgctgcagctcaatcg
caggcggacctgttgctcctagtggccaacgtataccgagcgaaggatggcgcggatata
acccgctttggagcccccttcagcatgaaggcacctcgtgactgctcataccaggatctg
cagaaacgaatgctccgcgaaatggcgccgctgctcaagccagaggtgttctcctatgcc
accccactggccgagatgttccgtattcggctgcaagacccatccgcagaccctgatacc
tatttggagcaagtggagcacccgttgcttaccgaaatgatcgacatggcgctttccgtg
ctttcctccgaggcaggaccccagcatataaagctccttttggagtggagttcacccgag
gcacactttatcagtaaacagcaggacacggaagaagccgtcgtggagcacgagagcgtt
gctcgtctaagtgccagcaagccgagcgacaccgctgcgctgactttggagcagtgcctg
gagcactataccaaggcagagactctgagtgccgaggatgcctggcgctgtccacactgc
cagcaataccttccagttgtgaagacgctgggtctgtggtcgctgcccgacatcctagta
gtgcatttcaagcgcttccggcaacatcaatctaaaggtccgcaagcggctaagctgaca
acaatggtcaagtttccgctgaccgccttcgacatgtcaccgcacttggcacgtggcgtg
catgaaagcgccagcagctcgctgggtatgggaacgggcattggacttggactcgggctg
ggctcgaatccctggaagaaagctcgttccgtcgactcgcggtcctccacacttaactcg
cgctgtgacgcaaaggatacgcggtacgacctttacgcagtgtgctaccatcagggagat
acattggaaacagggcattatacagctgcctgcaagaatccttacgaccgtcagtggtat
aagttcgacgaccagcgagtgagcaaggtgcctgaggacgacattgagcaggacataatc
aataatgaggcatacatgctcttctaccagcgacgcagtgtagatgcaggcgagtgttcc
ggttccagttcgaactccggagatcactgggtatcgcgaattgcgccagcctcatcatcg
tccgcatcatcgacgtcaggaaaggagagggagccggttaagttggaggaaaacacagaa
tctcctgcggcagtagaagtaacggagaaggctcagtccaagccggtggacatagtttgc
caggataaggcgaaaggtactgcagacggcccagacgctgatcaagaacagacaactgtt
ccacatgatttacaaattgaggaactggcattcgcggatgcagatgtagacaccagttta
ggagagaccatcaaggcggaggtaaatctagcggctaaggatgaacccaaaaaggtggag
gtagaggaagccacgcctatatttgccatggatgaagacggttccgaagctagacaggag
aagaaggaggaatgcgttaagaaggaagacgaactctccgaagccccagatgtgagcgaa
ctaaccgccgagtccaagaccaatggccacgtgagctcttcgtccagctcttcctcctcg
gaaagctcgctatcgtcccgctcctcgccgcgatcattgagtacttcagtcacagctgca
tctactctgcagagcaagttcaacggccacatgagcgccgctccagctcttttcaatgga
aatggaaatacgtcacagctctcgtccagcttgcaactatcccggcatgtgctgcacaac
catcaatggcacggatctaggagcagcgtgtcagctgtagagaatgctacgcaacatcaa
cagcagcaggcggcggccagtctgagccttcgtcattcgttttccacaagttcaaattac
acggagacactatcatccttgctacgcaaatcagcaaatacatgcagcaaggacacgctg
ctgtttatcgaccaacagagtcaccatcatacagccggactgatcgaagatgacgatgat
tcatacatgggcaggtccctttggatatcgcccgtaacgccacacaaactcatcactgtt
tcgcccaagaattag

DBGET integrated database retrieval system