KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3051Help
Entry
Dmel_CG3051       CDS       T00030                                 

Gene name
SNF1A
Definition
SNF1A/AMP-activated protein kinase (EC:2.7.11.- 2.7.11.16)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG3051 (SNF1A)
   04150 mTOR signaling pathway
    Dmel_CG3051 (SNF1A)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dmel_CG3051 (SNF1A)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmel_CG3051 (SNF1A)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dmel_CG3051 (SNF1A)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dmel_CG3051 (SNF1A)
  Mitophagy factors
   Other mitophagy factors
    Dmel_CG3051 (SNF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:2A1-2A1
AA seq 582 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVI
DTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFF
VAGSPPPPPPPPVPQSSMDHQAPLATVTVGGGTSASSGTATPVPPVAGGTPSSTIPIRPH
PERIAPMRDRQLAMSVQTSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRA
MKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDD
VIMESLTPPPLSVSGVMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctggtcaagattgggcactacctactgggcgcaaccctgggaacgggaaccttcggc
aaggtgaagatcggcgagcaccagatcacacgcgtcaaggtggccgtcaagatactcaat
cgtcagaagatcaaaagcctggacgtcgtgggcaagatccggcgtgagatccagaaccta
aagctcttccgccatccgcacatcatcaagttgtaccaggtcatatcgacgccgtcggac
atcttcatgatcatggagtacgtgagcggcggggagctgttcgactatattgtgaagcac
ggcaagctgcaggagcaccaagcgcgccgcttttttcagcagattatctctggcgtggac
tattgccaccggcacatgatcgtgcatcgagacctgaagccagagaacctgctgctcgac
cacaacatgcacgtgaagatcgccgactttgggctctcgaacatgatgctggacggcgag
ttcctgcgcacctcgtgcggctcgcccaactacgcggcgcccgaggtgatttccggcaag
ctgtacgccggtcccgaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccctttgacgacgagcatgtgcctacgctgtttcgcaagatcaagtcg
ggcattttccccattcccgagtacctcaacaaacaagtggtcaatctggtctgtcagatg
ctgcaagtggacccgctcaagcgggccaacatcgaggaaatcaagaagcacgagtggttc
caaaaggacctcccggcctacctcttcccctcgtccatcgagcaggactccaatgtgatc
gacacctacgctgtggcagaggtctgcaccaagttcggcgtcaaggagaccgaggtgcac
aactcgctgctcagcggcgatccgcacgatcagctggccatcgcttaccatctgatcatc
gacaacaaacgcttcgccgacgacgcggccaaccaaataaacgagatcaacaacttcttt
gtggccggctctccaccaccgccgccgcctccgcccgttccccaatcatcgatggaccac
caagcccctctggccaccgtgaccgttggcggaggtacctcagccagctcgggcaccgcc
acaccagtgccaccagtggctggaggcacgcctagcagcaccatacccattcgaccgcat
ccggagcggattgcgccgatgcgggaccgtcaactggccatgtccgtgcagacatctggc
ggcggagccttcccggagaaaaccgcacgtggcggcactcccatcaagcgcgccaagtgg
catctgggcatccggtcgcagagcaagcccaacgacataatgctcgaggtataccgagcg
atgaaggcactcagctacgagtggaagatcatcaatccgtaccacgttcgggtgcgcagg
cagaacgtgaagaccggcaagttctcgaagatgtcactgcagctgtaccaggtggacgcc
aagagctatctgctcgacttcaagtcgctgaccaacgacgaggtcgagcagggcgacgac
gtcatcatggagagccttactccgccgccgcttagcgtgtccggggtgatgccgctgcag
ccgaccggccaccacaccatggagtttttcgaaatgtgcgccgccctgatcattcaactg
gctcgctaa

DBGET integrated database retrieval system