KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3068Help
Entry
Dmel_CG3068       CDS       T00030                                 

Gene name
aur
Definition
aurora (EC:2.7.11.-)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:87A3-87A3; 3R:3-53 cM
AA seq 411 aa AA seqDB search
MSHPSDHVLRPKENAPHRMPEKSAAVHNMQKNLLLGKKPNSENMAPASKPLPGSSGALIR
KPGLGGSNSIASSEGNNFQKPMVPSVKKTTSEFAAPAPVAPIKKPESLSKQKPTAASSES
SKELGAASSSAEKEKTKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYLAREKESQFVV
ALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLF
NALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGW
SVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDET
YKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHTQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatccgtctgaccatgtgctgcgtcccaaggaaaatgctccgcacagaatgcca
gaaaaatcagctgcagtgcacaatatgcaaaagaacttgctattgggaaagaagcccaac
agcgagaatatggctccagctagcaaacccttgccaggatcctctggcgctttgatcagg
aagccaggcctaggaggctccaattccatagcttcctccgaaggaaacaacttccaaaaa
cccatggtgccgtccgtgaagaagaccacatcagagtttgctgctccggctccagtagca
cctatcaagaagcctgagtcactttccaagcagaaacccactgctgcgagctctgaatcc
tccaaggaactgggtgcggccagcagctccgctgaaaaagagaaaaccaagactgaaacc
cagccccagaagccgaagaagacctgggagctcaacaactttgatattggtcgcctgctg
ggacggggcaagtttggcaacgtttatttggcgcgggaaaaggaatcccagttcgtggtg
gccctaaaagtgctctttaagcgccagattggcgagtccaatgtggagcaccaggtgcgt
cgtgagatcgagatacaatcgcacctacgtcatccgcatatcctgcgtctgtatgcctac
tttcacgacgacgtgcgcatatatctgatcttggagtatgcgccacaaggaacgcttttc
aacgccttgcaggcacagccgatgaaacgtttcgatgaacgccagtcggccacctatatt
caggcgttgtgctcggcgctgctctatctgcatgagcgggacatcatacacagggacatc
aagccggagaacttgctgctcgggcacaagggcgtcctgaagatcgccgacttcggttgg
tccgtgcacgagccgaactccatgcgcatgacactgtgcggcactgtcgactacttgcca
cccgaaatggttcagggcaagccgcacacgaaaaacgtggatctatggagcctgggtgtg
ctctgctttgagctgctagtgggccacgctcccttctactcgaagaactatgacgagacc
tacaagaagattctcaaggtggactacaaactgccggagcacatttccaaggcagcatcc
catctcatttccaagctgctggtccttaatccgcagcaccgcctaccgctggatcaggtg
atggtgcatccttggatcctggcgcacacgcagtga

DBGET integrated database retrieval system