KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31002Help
Entry
Dmel_CG31002      CDS       T00030                                 

Definition
(RefSeq) CG31002 gene product from transcript CG31002-RA (EC:2.4.1.17)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG31002
   00053 Ascorbate and aldarate metabolism
    Dmel_CG31002
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG31002
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG31002
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG31002
   00982 Drug metabolism - cytochrome P450
    Dmel_CG31002
   00983 Drug metabolism - other enzymes
    Dmel_CG31002
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG31002
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG31002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:100C3-100C3
AA seq 521 aa AA seqDB search
MPPIFLLVCLLPGYSEGARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREP
FRNIHDIPVPEVFENFNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGP
QKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSPSSR
FYDLEAYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVL
VNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSK
SLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITH
GGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLT
NKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVF
GTFLVGALVILGIVTYLLVMTLRKCLFLIKRGKCEAIKKIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaatctttctgctcgtatgtcttcttcctggttactcggaaggtgctcgcatc
ctggcagtgttccctttgccaagttcttcgcattactttttcgccttaccctaccttaag
agtttggcctccctgggccacgaaataaccagtgtaagtccgtatccacaaagggagccg
tttaggaatatacacgatattccagttcccgaggttttcgaaaactttaatgaggtcctt
aggattgcatctactcccaggagcacctggcaaagtagtgatttcatcaacgaatatgtc
cttaatcttacgaagacagtgctgaataacgagggcgtaaggcgcgatattctaggccca
cagaagccccatttcgatcttgtgataatggatctctggcgaatggacgtgctcagtggc
ctggctgcctattttgatgccccgatcatcggaatggcttcctatggcaccgactggaag
attgacgaactgatgggcaacgtctcaccgatttcttacctgcagtctccctcttctcga
ttctacgatctggaggcctatggagagcggttgttgcacctgatggagcgaactttttct
tatatgaactataaatggcgacatgtgagaaaacaggagactctctatagtcaatttttc
cccagcgtcgctgagcggaaacccttgtcagagatatcccggaactttgatttggtcctg
gtcaatcagcacttcacactgggtcctcctcgtccttatgttccgaatatgatccaggtg
ggtggtctgcatgtcgatcacagcacagaggctctgtccgccgaactggaccactttatc
caaggtgctggtgaatcgggggtaatctatttctcactgggaaccaatgtcaaaagcaaa
tcgctatccgaggatcgtcgaaaggtattgctcgagactttcgccagcttgccacagcga
atcgtttggaagttcgaagatgaactgctgccaggaaaaccccccaatgttttcattagt
aagtggttcccgcagcaggccatcctggcccatcccaatgtaaaactctttataacccac
ggcgggctactgagcactatagagagtattcaccatggaaagcccatgttggggttgccc
tgcctattcgatcagtttcgaaatatggatcatgtccggcaagtgggtcttggtttggtc
ctcaacataaagcaaatgaccagtgaggaatttaggtctacaattatacggctgctaacg
aacaagagtttcgaagaaacggcaaggatcacggctgccagatatcgggatcaaccaatg
aagcccatggaaacggcgatctggtggaccgagtatgtcctgtctcacaagggagctgct
cacatgcaagtcgccggcaaggacttgggttttgtaagataccacagtctagatgtcttc
ggcacttttttggttggcgctttagttatcctgggaattgttacatatctgttggttatg
accttaaggaaatgcctctttttaataaaaaggggtaaatgtgaggcaataaagaagatt
cagtaa

DBGET integrated database retrieval system