KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31119Help
Entry
Dmel_CG31119      CDS       T00030                                 

Gene name
HdacX
Definition
Histone deacetylase X (EC:3.5.1.-)
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmel_CG31119 (HdacX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:96B1-96B1
AA seq 343 aa AA seqDB search
MKRLTERVHHEEQESEEVVWVKRDDARSAGKLPIVFSRNYAVRFGGLERLHPFDAAKGKH
IHKLLCAQLQLDDGSFYEPTELTKDQLRRIHTREYLKSLRWSMNVACIAEVPLMAFVPNR
YIQRSYLRPMRFQAAGSILAGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVR
LFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYIFDMYNAFVYPRDHVAKESIRCAV
ELRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAISAEGVIERDR
LVFSTFRALGIPVVMLLSGGYLKASAGVITDSIVNLRLQGLLN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctgactgagcgagtgcaccacgaggagcaggagtccgaggaggttgtctgg
gttaagcgggatgacgcacgctccgccggcaaactgcccatcgtgttctcaaggaactat
gcggttcgcttcggtggccttgaacgcctacatcccttcgatgcggccaagggcaagcac
attcacaagctcctgtgcgcccaactgcagctcgacgacggcagcttctacgaacccacg
gagctgaccaaggaccagctgcgtcgtattcacacaagggaatacctaaagtcactgcgc
tggagcatgaatgtggcctgcatcgctgaagtgccgctgatggccttcgtcccgaatcga
tacattcagcgttcctatttgcgacccatgcgctttcaagcagccggttccattttggcc
ggtaagctggcattggattatggttgggccatcaacctgggcggtgggttccatcactgt
tgctcgtacagaggcggtggtttctgtccatatgctgacatctcgctgctcatcgtcagg
ctgttcgagcaggaaccattccgggtgcgccgcataatgattgtggacctggatgcccat
cagggcaatgggcacgagcgggacttcaataacgtggcagccgtctacattttcgacatg
tacaatgcctttgtctatccgcgggatcatgtggccaaggagagcattcggtgtgcggtg
gagctgcgcaactacacggaggatggattctacctgcggcaactaaaacgctgcctgatg
cagtccctggccgagttccgtccagatatggtcgtctataatgcgggaaccgatgtgctc
gagggcgatccattgggcaacctggctatttccgcggagggcgttattgagcgggatcgg
ttggtatttagtacatttcgggcattaggaattccggtggtgatgctgctgagtggtggc
tacttgaaggcatccgcaggggtaattacagattcgattgttaatcttcggcttcaagga
ttgctaaactaa

DBGET integrated database retrieval system