KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31148Help
Entry
Dmel_CG31148      CDS       T00030                                 

Definition
CG31148 gene product from transcript CG31148-RA (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dme00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dme00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dme04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:95A8-95A8
AA seq 561 aa AA seqDB search
MGKMFASRGMLVLGVLLVSAIGGQSESIPCKLIDAEHGKVCVCTADYCDYLENPVLTDEN
EWFLISSSKQGLRFSTTSDKFGKEEKFTVQDYVEPTQETANATILSRLLDKVVDSAFTLE
SRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVEYLVENFKHSELADHLYKSFYAEDGL
GFNLMRVSIGGCDFDLEPWSYAEEEGDTELSDMDELNAHDVTRVAQIKRLIEVSGVKNLL
VKGAAWSSPPWMKTNNRWTGFGRLKRAYYQTWADYHLRWLRLMKDNGIPIWAISTGNEPL
NGIIFMYFVKFMSLGWTPQTQAIWLNDYLGPTIRNSEFKDITLFGNDDQRYSFPHWFKMM
NRTRPNSIDYLDGLSLHWYWDEIFGNSFIEQTKEYAPDKILIVSESCIGDKPWQAAAPLL
GSWERAEKYARDYLLNIKLGFHGWIDWNICLDEIGGPNYVDNTVDAPVIVNTTTFEEFYK
QPMFYAIGHFSKWVPEGSVRIDAVPSNVNLDSVAFLRPDNKITAVLFNSGRADLDITLVD
SIRGQFVVNVPAKSIHTLLYS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatgttcgccagcagaggaatgctggtgcttggagtgcttctggtatcagca
attggtggccaatcggaatcgatcccctgcaaactcatcgatgcagaacatggcaaagtg
tgcgtctgcacggcggactattgtgattatctggagaatcccgtcctgacggacgaaaat
gagtggttccttatctccagttccaaacagggacttcggttctccacaactagtgacaaa
ttcggtaaggaggagaagtttaccgtgcaggattatgtggaacccacgcaggagactgcg
aatgcgacaatcctgtctcgtttgctcgataaggtggtggacagtgcttttaccttggag
tcccgggagagttccataactcgcactgtaaccctgcgactggacagaagtaagacccac
cagaagatggttggtttcggtggcagctacaccggagcagtggaatacctggtagagaac
ttcaagcattcggaactggctgaccatctgtacaagtccttttacgccgaggatggactg
ggcttcaatctcatgcgagtttccattggcggctgtgactttgacttggaaccctggtcc
tatgccgaagaggagggcgacaccgagctatccgatatggatgaactaaacgcgcatgat
gtgacgcgagttgcacagatcaagcgtctcattgaggtgtccggagtgaagaatctgttg
gtcaaaggagctgcctggagttccccgccctggatgaagacaaacaacaggtggacagga
tttggacgcctcaagagggcttactaccagacttgggccgattaccatctgcgttggcta
agacttatgaaggacaatggcattcccatttgggccatttccacgggcaacgaaccattg
aatggcatcattttcatgtatttcgttaagttcatgagcttgggatggacgccacagact
caggccatttggctgaacgattatctgggtcccacgatccgtaactctgagttcaaggac
atcaccctgtttggcaacgatgaccaacgctattcctttccccattggtttaaaatgatg
aaccgcactcgaccaaactcgattgattacctcgatgggctatcgctgcactggtattgg
gatgaaatatttggcaacagctttatcgaacagaccaaggaatatgcccccgacaagatt
ttgatagtttccgagtcctgcataggggacaagccctggcaggcagctgctcctctgctg
ggaagctgggagcgggccgagaagtatgccagagattacttgcttaacattaagctgggc
ttccatggctggattgactggaacatttgtctggacgagattggcggtcctaactacgtg
gacaacacggtggatgccccagtgattgtgaatacaacaacattcgaggagttttacaag
cagcccatgttctatgccattggtcacttctccaagtgggttccagagggatccgttcgc
atagatgcagtacctagtaatgttaatctggattccgttgcattcctgcgaccggacaac
aaaatcaccgccgttctcttcaatagtggtcgcgccgatctggacatcactttggtggat
agtattcggggtcagttcgttgtcaatgttccggccaaatccattcacactctgctgtac
agttga

DBGET integrated database retrieval system