KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31196Help
Entry
Dmel_CG31196      CDS       T00030                                 

Gene name
14-3-3epsilon
Definition
(RefSeq) 14-3-3epsilon, isoform A
  KO
K06630  
14-3-3 protein epsilon
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dmel_CG31196 (14-3-3epsilon)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    Dmel_CG31196 (14-3-3epsilon)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG31196 (14-3-3epsilon)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 262 aa AA seqDB search
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASW
RIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVF
YYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEV
DPNAGDGEPKEQIQDVEDQDVS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgagaacaatgtgtacaaggcaaagctggccgaacaggccgagcgctac
gacgaaatggtggaggccatgaagaaggtcgcctccatggacgtagagctgaccgtcgag
gagcgaaatctgctgtcggtggcgtacaagaatgtgattggagcacgccgtgcctcgtgg
cgcatcatcacctcgatcgaacagaaggaggagaacaagggggccgaggagaaattggag
atgatcaaaacctaccgcggacaggtggagaaggagctgcgcgacatctgctcggatata
ctgaacgtgctcgagaagcatctcattccatgcgccacatccggcgaaagcaaagtattc
tactataagatgaagggcgactaccatcgctacctggccgaattcgccaccggctccgac
cgcaaggatgcggcagagaactcgctgattgcctacaaggcggccagcgatattgccatg
aacgatctgccaccaacacaccccatccgtttgggcttggcattgaacttctcggtgttc
tactatgagattctcaactcgccggaccgcgcttgccgcttggcgaaagccgctttcgat
gatgccattgccgagttggatacactgagcgaagagagctacaaagactcgacactcatc
atgcagctgctgcgcgacaacctcacattatggacgtccgatatgcaggcagaagaagta
gaccccaacgcaggtgatggcgagcccaaagagcaaatccaggatgttgaggatcaggac
gtgtcgtaa

DBGET integrated database retrieval system