KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31362Help
Entry
Dmel_CG31362      CDS       T00030                                 

Gene name
Jon99Ciii
Definition
Jonah 99Ciii (EC:3.4.21.-)
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99C7-99C7
AA seq 265 aa AA seqDB search
MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGN
WWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNL
HNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVD
VQIISQSDCSRTWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQ
SGAPAVFSRVTGYLDWIRDNTGISY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcgtattcctggccttggccgtggccgcagctactgctgtgcccgctccc
gcccagaagctgaccccgacgcccatcaaggacattcagggtcgcatcaccaacggctac
ccagcctacgagggcaaggtgccttacatcgtgggtctgctcttcagcggcaacggaaac
tggtggtgcggtggctcgatcatcggcaacacctgggtcctgaccgccgctcactgcacc
aacggagccagtggagtgaccatcaactacggagccagcatccgcacccagccccagtac
acccactgggtgggcagtggcgacatcatccagcaccaccactacaacagcggcaacctg
cacaacgacatctccctgatccgtaccccgcacgtcgacttctggagcctggtcaacaag
gttgagctgcccagctacaacgaccgctaccaggactacgccggatggtgggccgtggcc
tccggatggggcggcacctacgatggcagcccactgcccgactggctccagtccgtcgat
gtccagatcatttcccaaagtgattgcagccgcacctggtctctccacgacaacatgatc
tgcatcaacactgacggaggcaagtccacctgcggaggcgactctggtggccccctggtt
acacacgacggcaaccgcctggtcggagtgacttccttcggatccgccgctggctgccag
tctggtgctcccgccgtcttcagccgcgtcaccggatacctggactggatccgcgacaac
accggcatctcctactaa

DBGET integrated database retrieval system