KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31362Help
Entry
Dmel_CG31362      CDS       T00030                                 

Gene name
Jon99Ciii
Definition
(RefSeq) jonah 99Ciii, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 43543
NCBI-ProteinID: NP_001287598
FlyBase: FBgn0003357
UniProt: C0HKF7 C0HKF8 A0A0B4LHX9
Position
3R
AA seq 265 aa AA seqDB search
MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGN
WWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNL
HNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVD
VQIISQSDCSRTWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQ
SGAPAVFSRVTGYLDWIRDNTGISY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcgtattcctggccttggccgtggccgcagctactgctgtgcccgctccc
gcccagaagctgaccccgacgcccatcaaggacattcagggtcgcatcaccaacggctac
ccagcctacgagggcaaggtgccttacatcgtgggtctgctcttcagcggcaacggaaac
tggtggtgcggtggctcgatcatcggcaacacctgggtcctgaccgccgctcactgcacc
aacggagccagtggagtgaccatcaactacggagccagcatccgcacccagccccagtac
acccactgggtgggcagtggcgacatcatccagcaccaccactacaacagcggcaacctg
cacaacgacatctccctgatccgtaccccgcacgtcgacttctggagcctggtcaacaag
gttgagctgcccagctacaacgaccgctaccaggactacgccggatggtgggccgtggcc
tccggatggggcggcacctacgatggcagcccactgcccgactggctccagtccgtcgat
gtccagatcatttcccaaagtgattgcagccgcacctggtctctccacgacaacatgatc
tgcatcaacactgacggaggcaagtccacctgcggaggcgactctggtggccccctggtt
acacacgacggcaaccgcctggtcggagtgacttccttcggatccgccgctggctgccag
tctggtgctcccgccgtcttcagccgcgtcaccggatacctggactggatccgcgacaac
accggcatctcctactaa

DBGET integrated database retrieval system