KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31414Help
Entry
Dmel_CG31414      CDS       T00030                                 

Definition
CG31414 gene product from transcript CG31414-RC (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmel_CG31414
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dmel_CG31414
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmel_CG31414
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dmel_CG31414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:95A9-95A10
AA seq 566 aa AA seqDB search
MPDMKTPLLGFLTTVIAISAGAPDWQLPCDLRETSHGSVCVCNSTYCDYLEPPQLTDISQ
IVVISSSKDGLRFKKTTGDLSKKKPITIDDKQFTDENFKADAIVVDQERAWLQLANIPQS
LFINASIKTYRIFVKREQSFQNVSIFGGAFTGTVSYLLKELPVELQDHVYRSYFHPVGIA
YNTIRMSIGGSDFDMEPWAYNELPLHDPKLSNFTELDPRDLQKVEQLKRLKIIGKVDSLK
IMGAAWSAPTWMKSNNRWTGFGQLKSEYYQTWALYHLKFLELMRSKNMPIWAISTGNEPL
NGVIGFFFVHFMSMGWTPWQQAIWLNDNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRKM
RSSRNNSLNYLDGLAVHWYWDELIGPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPEL
GSWQRGESYMRAYTQDLTHNFNGWLDWNLVLDEQGGPNYVKNFVDAPIIVNATSRSEIYK
QPIFYAIGHFSKFLPPDSVRIETRIENQSNPFTQLSVVGFQRPDGSVALIIYNGQNLPVD
VTLDDSQRGAIQLRLPPRSWHTVLYK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgccagatatgaagacaccactgcttggctttcttactacagtgatcgcaatctctgca
ggtgctcccgactggcagttgccctgcgatttgcgcgaaacgagccatggaagcgtgtgt
gtctgcaacagcacctactgcgattatctggaaccgccccagctcactgatatctcgcag
attgtggtgattagctccagcaaggatggcttacgcttcaagaagacgacaggggatctc
tcgaaaaagaaacccataacaatagatgacaaacagttcaccgatgagaacttcaaggca
gatgcaattgttgtggatcaggagagggcctggttgcagttggccaacattccccaaagc
ctgtttattaatgccagcattaagacatatcgcatattcgtgaaacgagagcagagtttt
caaaatgtctccatttttggtggggcatttacaggaacagtctcgtacttactcaaagaa
cttccggtggagctacaggatcatgtctatagatcctattttcatccggttggaattgct
tacaacactatacgaatgtccattggcggttccgactttgatatggaaccctgggcatac
aatgaattgcctcttcatgatccgaaattgagcaactttaccgaactcgatccgcgggat
ctgcagaaagtggaacagttgaaacgccttaagatcatcggtaaagtagattctctgaaa
atcatgggcgctgcctggagtgctccaacctggatgaagagcaataatcgctggacagga
ttcgggcagctgaaatcggaatactatcaaacgtgggccctctatcacctcaaatttctc
gaactcatgcggtctaaaaatatgccgatttgggccatatccactggcaatgagccgtta
aacggcgtcattggcttcttttttgtacacttcatgagcatgggctggacgccctggcag
caggctatctggctgaacgacaatctgggcccgaccatcagaaactcggcggagagcaag
gtgctcatctttggcaacgacgatcagcggtacacctacccaacgtggttccgaaagatg
cgctcctcccgcaacaattcgctgaactacttggatggcctagctgttcactggtactgg
gatgaactgataggaccacaactcatcgaccaggcacatacggatatgcccaataagctg
ctattgaacacggagtcctgcatcggtgataagccatggcagacccatggtcccgagctg
ggcagctggcagcgtggtgaaagctatatgagggcctatacccaggatctgacgcacaac
ttcaacggctggctggattggaatctcgtgctggacgaacagggcggtccgaactacgtt
aagaactttgtggatgctccgattattgtgaatgccacgagtcgttctgagatatacaaa
cagccgattttctatgccataggccacttctccaagtttctgccgccggactccgtgcgc
atcgagacgcggatcgagaaccagagcaatcccttcacccagctgagtgttgttggcttc
cagcgaccagacggcagtgtggcgttgataatctacaatggccagaacctgccggtggac
gtgactctcgatgatagccagcgtggagcgatccagcttcgcctgccgccgcgctcctgg
cacacggtgctctacaaatga

DBGET integrated database retrieval system