KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3166Help
Entry
Dmel_CG3166       CDS       T00030                                 

Gene name
aop
Definition
anterior open
Orthology
K03211  
ETS translocation variant 6/7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG3166 (aop)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG3166 (aop)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    Dmel_CG3166 (aop)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2L:22D1-22D1; 2L:2-12 cM
AA seq 732 aa AA seqDB search
MSKMKMLPVQLSLNSLNPGIWSDVLWRCPPAPSSQLAELKTQLPPSLPSDPRLWSREDVL
VFLRFCVREFDLPKLDFDLFQMNGKALCLLTRADFGHRCPGAGDVLHNVLQMLIIESHMM
QWHLPNSPVTPTSRYPLSPHSHPPTPTWPPLNAPPENSPFHSSAHSLAGHHFMAPNSVTL
SPPPSVDSQASSPPQAPYQNGGATGAAPGSAGGSAPAAGGATNTSNPTSSSASSTGSNGS
QPNIMPMKGISSASSNHSDSEEEYSETSGGVSKMPPAPLSYSTASPPGTPILKDIKPNWT
QQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPV
VTPAGGSISAPTTPSYMYKAKREFFPENSEPNTNGRLLWDFLQQLLNDRNQKYSDLIAWK
CRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQFLR
NPTELKNIKNISLLRQSTPANGNGGSPSMPQGSSQAPGSPAGQNWNPQQQSQQQQQSPQR
PASRNGPMSLPAVAAVAAAAAAAYGPPPTSPLFMHAINGAFHYLSAAAAGPPPNSPALNT
PSAVGGPDKFQFHPLKLENGSGSGSESAGEDLKPTDLSVSSKSTATSNEDCYPLIRNADG
LTTIKLIRYNEHQVAASPAGQSPKHDDQQAGASNASSSPRPMDQASEQAQPVPMESDCNG
GESEDSFRHMQQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatgaaaatgctcccagtacagttatcattgaactcgctgaatcccggcatc
tggagcgatgtgctgtggcgctgtcccccagcgccgtccagccagctggcggagcttaag
acgcaactgcccccatccctgccttccgatccgcgcctctggagccgcgaggatgtgctt
gtcttcctgcggttctgcgtccgcgaattcgatctccccaaacttgactttgatctcttc
caaatgaacggcaaggcgctgtgcttgctgacgcgggcggactttggtcaccggtgtcct
ggggcaggagatgtgctccacaatgtgctgcagatgttgatcatagagtcccacatgatg
cagtggcacctgcctaatagtccagtgacgcccaccagtcgttatcccctgtcgccgcac
agccatccgccgacgcccacgtggccaccgctgaatgctcctcccgagaacagtcccttc
cacagttctgctcacagtctggcaggccaccattttatggcgcctaactcggttacgctg
agtcctccgccctcggtggattcccaggcgagtagtcctccccaggcaccttaccaaaat
ggaggagccactggagcagcaccaggatcagcaggaggatcagcaccagctgcaggagga
gccacaaacaccagcaatcccacgtcgtcgagtgccagcagcaccggcagcaatggctcc
cagccgaacattatgcccatgaagggtattagcagtgccagcagtaatcactctgattcc
gaggaggagtactctgagaccagtggtggagtgagcaagatgccaccagcaccactgtcc
tacagcacggccagtccgccaggaacacccatactgaaagatattaagccgaattggacg
caacagctcacgaatagttttgtgaactcatggtcccagcagcagcaacagcagcagcag
caacaagctgctgcagtggccgcagtagctgctcaggcgcagcagcaccagttgcagcag
cagcagcagcaacaacaattgccccagaagctgaccctggataatactgctggtccagtt
gtgacccctgctggaggatccatctccgcacctaccacgcccagttatatgtacaaagca
aagagggagttcttccccgagaattctgagcccaatacaaatggccgcctgttgtgggac
ttcttgcaacagctgctgaacgatcgcaaccagaagtacagcgatctgatagcctggaaa
tgccgcgatacgggagtcttcaagatcgtcgaccccgccggactggcaaagttgtggggc
atccagaagaaccatctgtccatgaattacgacaagatgtcgcgtgccctgcgttattac
tacagggtaaacatactgcgcaaagtgcagggcgagcgacattgctatcagtttctgcgc
aatcccacggaactgaagaacatcaagaatatatcgcttttgcgtcaatcgacaccggcg
aatggcaatggcggcagtccatcaatgccacagggtagcagtcaggcacctggaagtccg
gctggccaaaactggaatccccagcagcagtcccagcagcaacaacaatcaccacagcgg
cccgcctcgcgtaatggtcccatgagcctgcccgccgttgcagcggtagcagcagcggct
gctgcggcctatggtccaccacccacatcgccgctcttcatgcacgccatcaatggagcc
ttccactacctttcggcggcggcagctggtccgccacccaattcccctgccctaaacaca
ccatccgctgttggaggacccgacaagttccagttccatcccctcaagctggagaatggc
tcgggatcgggttcggaaagcgctggcgaggatctgaagcccacggacctcagtgtgagc
agcaagagcactgctaccagcaacgaggactgttatccactcattcgcaacgctgacggc
ctgacgaccatcaagttaatacgatacaacgaacaccaggtagccgcttcgccagcgggg
cagtcccctaagcacgatgaccagcaggcaggcgcctccaatgccagcagctcacccagg
cccatggatcaggccagtgaacaggcacagccagtgccgatggaaagcgattgcaatggc
ggcgagtcggaggactccttccgacacatgcagcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system