KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31762Help
Entry
Dmel_CG31762      CDS       T00030                                 

Gene name
aret
Definition
arrest
Orthology
K02177  
bruno
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG31762 (aret)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmel_CG31762 (aret)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2L:33D3-33D5
AA seq 604 aa AA seqDB search
MFTSRASFLANRRMIFDFSEKNNDIYLDAFGMSDKSSSATNSLPNSPIHSNNNNPSLLNN
NNNNSNGTSSNNSLNVGNNNSNPSLGGSNSNALVSVGSNGIMSAAGLVNNNNNPCSANRN
VVAMVDDDACFRLDTDATVTYGEKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSI
NVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKL
FVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLS
QNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPILPN
PPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAAAGL
LTPMTVQNLAAIAAMTQPSLSNAAAAAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTA
AGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTF
LPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPKD
SKPY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccagccgcgcttcgtttttggccaatcgccgcatgattttcgatttctccgag
aagaacaacgatatctacttggatgcttttggtatgagtgataagagcagcagtgcaacg
aacagcctgccgaatagtcccatacacagcaacaacaataatccatcgctgctgaacaac
aacaacaataacagcaacggcaccagcagcaacaacagcttaaacgttggcaacaacaac
agcaatccgagcttgggcggcagcaacagcaacgcactggtttccgtaggcagcaacggt
ataatgtccgccgccggtttggtcaacaacaataacaatccgtgcagcgccaaccgcaat
gtggtcgccatggtcgacgatgacgcctgcttccgtctggatacggacgccacggtgacg
tacggcgagaaggaaccggatccggacaacatcaagatgttcgtcggccaggtgcccaag
tcgatggacgagtcgcagctgcgcgagatgttcgaggagtacggcgccgtgcactcgatc
aacgttctgcgggacaaggctaccggaattagcaagggttgctgctttgtgacattttat
acgagacacgccgccctgaaagcccaggatgctttgcataatgttaagacgctaaatggg
atgtaccatcccattcaaatgaagcccgccgatagcgagaatcgcaatgaacgcaaactc
tttgtgggtatgctaaacaagaagctgaacgagaacgacgttcgcaagctatttgaagtc
cacggagccatcgaggagtgcaccgtccttcgggaccaaaacggacagagcaagggttgt
gccttcgtcacattcgccaccaagcacgctgccatttcggccattaaagtgaccctgagc
cagaacaagatcatggagggctgcacatcgccgctggtcgtcaagttcgccgatacgcaa
aaagagaaggagcagaagaagattcagcaaattcaggccaatctctggaacctggccagc
aacatcaacatacctctgggccaaacggccaccagcgtgaccacgcccatcctgcccaat
ccgccgcagcagccttcgccggttctcggcgcagatgccattaccccggcctccattcaa
ctgctgcagcagctgcaggcggtgggactgcagcaccagttgttgcaagccctcacagga
ctgggagcccagcagagcagctcggcgacggacaccagcgctgtggcggccgcaggactt
ttgaccccgatgaccgtccagaatctagcggccattgcggccatgacgcagccgagtctc
tcgaatgccgccgcggcagccgccgctgccacatcgcctggaagcgcccaactgaccaac
acggctgcgctgctctggtccgatccgaatccaatggcatcggcatatatgtcaacagcc
gccggtctgccgcaattcgggagcgccagtgcattgtccacttcgccgctggccagcgtt
gccctcagcgccgcagccgccgccgcagcgggaaagcagattgaaggacccgagggctgc
aaccttttcatctaccatctgccgcaggagttcaccgatacggatctggcctccacgttc
ctgcccttcggcaatgtgatctcggccaaggtgttcatcgacaaacagacgagcctgtcg
aagtgcttcgggtttgtctccttcgacaatccggactcggcccaggtggccataaaggcg
atgaacggcttccaggtgggcaccaagcgtctcaaggtgcagctgaagaagcccaaggac
tcgaagccctactag

DBGET integrated database retrieval system