KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32068Help
Entry
Dmel_CG32068      CDS       T00030                                 

Definition
CG32068 gene product from transcript CG32068-RB (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dme00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:67E6-67E6
AA seq 186 aa AA seqDB search
MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKR
GYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKV
VKGDLIIIPAGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENF
VQFNKV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtttggtatatggatacggaggaaaccgatcagcgcctggagcaccaccgc
aatccgcctgcctacttggaactggatgatctgtaccagaagaccggcgtggaatacttt
aagatcaatgcggacgagtaccagagcgataataccctcacggaactgagggcaaaacgt
ggctacacctacgatgatgagatcacatgctcggaaaagtgccttccagactatgccaac
aagttgaaagcctttttcaccgaacacctgcacacggatgaggaaattcgcctgatattg
gagggatccggttactttgatgttcgcgacaatgaggacaactggttgcgcattaaggtt
gtcaagggagatctgatcattataccagctggcatatatcaccgctttactttggatacc
aataactttatcagaactcgtcgctattttgtgggcgaacctgtctgggctccacacaat
cgtcctgctgatgaaatggactgtcgcaaatcgtacatcaagcatcagtcggaaaacttt
gtgcaattcaataaggtttaa

DBGET integrated database retrieval system