KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32068Help
Entry
Dmel_CG32068      CDS       T00030                                 

Gene name
Adi1
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00270  Cysteine and methionine metabolism
dme01100  Metabolic pathways
Module
dme_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dmel_CG32068 (Adi1)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dmel_CG32068 (Adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dmel_CG32068 (Adi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 DUF2116
Motif
Other DBs
NCBI-GeneID: 326189
NCBI-ProteinID: NP_001097577
FlyBase: FBgn0052068
UniProt: Q6AWN0
Position
3L
AA seq 186 aa AA seqDB search
MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKR
GYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKV
VKGDLIIIPAGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENF
VQFNKV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtttggtatatggatacggaggaaaccgatcagcgcctggagcaccaccgc
aatccgcctgcctacttggaactggatgatctgtaccagaagaccggcgtggaatacttt
aagatcaatgcggacgagtaccagagcgataataccctcacggaactgagggcaaaacgt
ggctacacctacgatgatgagatcacatgctcggaaaagtgccttccagactatgccaac
aagttgaaagcctttttcaccgaacacctgcacacggatgaggaaattcgcctgatattg
gagggatccggttactttgatgttcgcgacaatgaggacaactggttgcgcattaaggtt
gtcaagggagatctgatcattataccagctggcatatatcaccgctttactttggatacc
aataactttatcagaactcgtcgctattttgtgggcgaacctgtctgggctccacacaat
cgtcctgctgatgaaatggactgtcgcaaatcgtacatcaagcatcagtcggaaaacttt
gtgcaattcaataaggtttaa

DBGET integrated database retrieval system