KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3218Help
Entry
Dmel_CG3218       CDS       T00030                                 

Gene name
fs(1)K10
Definition
female sterile (1) K10
Orthology
K02524  
DNA binding protein (fs(1)K10, female sterile(1)K10)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG3218 (fs(1)K10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:2F1-2F2; X:1-0.5 cM
AA seq 463 aa AA seqDB search
MVSKNQFYQNWTMQSQQQHPHQMQQQFQQQQQPNLQHRNNQSNNNNCNNNPRAAAAPYRK
PFRSGKINSGPGGNGNGNRVNGNNQMMFSSSQMPSDPLYIDFSSPPPGFKHNQVGSPKKK
SMKGIKQQQHPSPNQQQPPSPNQQQHPSPNQQQHPSPNQQQHPNSNQQQHLSPNQQQGKM
NNQNNNHMNQSQQPFNNQMNGSDWQRHPGNNPNQIRGGFNGFQRGPPPNRPPPRLMMGPP
MGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGP
GPMMGVPPPMHMMGPRMPPRGIPPVGPYGPMNMNGGRIMKPNPKLIKQVVKGKSSIKTLK
NLINQYPIEKPWVTDEIRSEHDKKVDIENRLKGHKDDELFAQYKGQRDKFVSLYEAAREE
YLKQEAATVKAKDAKSDKDKNAISSQSAAPKAGSAKDATIPNP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccaagaaccaattctatcagaactggaccatgcagtcgcagcagcagcacccg
caccaaatgcagcaacagtttcagcaacagcagcagccaaatctgcagcaccgcaacaac
cagagcaacaataataattgcaacaataatccccgcgcagctgcggctccgtatagaaaa
ccgtttcgttcgggcaaaattaactccggaccaggaggaaatgggaatggtaacagggtc
aacggtaacaatcagatgatgttttcctccagccaaatgccgagcgatcccctgtacatt
gacttcagcagcccgccaccaggattcaaacacaatcaggtaggcagtcccaagaagaag
tctatgaagggcatcaaacagcagcagcatcccagtccgaaccagcagcagcctcccagt
ccgaaccagcagcagcatcccagtccgaaccagcagcagcatcccagtccgaaccagcag
cagcatcccaattcgaaccagcagcagcatctcagtccgaaccagcagcagggcaagatg
aacaaccagaacaacaatcatatgaaccagtcgcagcagcccttcaacaatcagatgaac
ggaagcgattggcagcgccatccgggcaacaatcccaatcagattcgcggtggctttaat
ggattccaacgcgggccgcctccgaaccgtcctcctccacgcctcatgatgggtccgcca
atgggtccgatgggccccggaccacggggacccggaccgatgggccctggaggaccttac
ccgcaaatgcctttcccgccaccggtgcctggtatgcgcggtcccggacccatgggcccc
atgggtggaccaccaccgccgccgccaccgctctttatgcgtcgcaacggacccggtcca
ggtcctatgatgggtgtcccaccgcccatgcacatgatgggtccacggatgccgccgcgg
ggaattccaccggtcggaccttatggaccaatgaacatgaatggcggccggataatgaag
cccaatcccaagctaatcaagcaggtggtgaaaggcaagagcagcataaagacactaaag
aacctgatcaatcagtatcccatcgaaaagccctgggtaacggacgagatacgcagcgag
cacgacaagaaggtggacatcgagaacagattgaagggccacaaagacgacgagctcttc
gctcagtacaagggccagcgggacaagttcgttagtctctacgaagcggcgcgggaagag
tatctcaagcaggaggcagccactgtcaaggccaaggatgccaagtcagacaaagacaaa
aacgcaatttcaagtcagagcgcagcccctaaggccggaagcgctaaagatgcaacaatt
ccaaatccctag

DBGET integrated database retrieval system