KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32351Help
Entry
Dmel_CG32351      CDS       T00030                                 

Gene name
S-Lap2
Definition
Sperm-Leucylaminopeptidase 2 (EC:3.4.11.-)
Orthology
K11142  
cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dme00330]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dme00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:66D8-66D8
AA seq 552 aa AA seqDB search
MFRFSRNAITRACSLSIRRPEVIRHRRYASQAINQMLQLQQMEICADPPSRGLVVGVYAD
EEDKNDAGILTPTGWKYNVQKTHGRLLEVLRMSGPMPKRGETRLLFAVEPERVPYYSAVA
VIGLGKECLGYNPYEVLDEQKEAIRRSVADACRILAELDTDRIEVENCGHAESAAEGAAL
GIWIYQELRDPKRRISVPSIDLYATKDEICDIEGWRIGLQKAAAQNLTRQLQEMPSNLLT
PTAFAQNVVEVLCKSGVNVEVKVEGWAESQSMHAFLAVGKASCEPPIFLELSYYGTCAEE
RPIVLVGQGVTYDAGGLCLKEKQELFHMRGDMTGAAVVVATCRAVAGLRLPVNIRGLIPL
CENVIGCNSFRPGDMVKSMNGKTIEVQCTDHEDVLVLADALLYGQNFCPKCIIDIGTCSG
YMRQALDEAACGVFTNSEILWQQIKHASMHTGDRVWRFPLWNYYSKAVRAGGRSDVQNYG
IGRGGRPCKAAAFLREFVPCGQWMHIDATNVMITRGDEFEYLREGMAGRPTRTLIEFIAQ
SICKDTAPKLNK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggttttctcgcaatgccataacccgggcgtgtagtctctccattcgtcggccg
gaggtgatccgtcatcgcaggtacgcctcgcaggcgatcaaccagatgctgcagctgcag
cagatggagatctgcgcggatcctccgtcgcgtggcttggtcgttggagtctacgccgac
gaggaggacaagaacgacgctggcatcctgacgccaaccggctggaagtacaatgtgcag
aagacgcacggtcggttgctagaagtgctgcgaatgtccggacccatgcccaaaagggga
gagacccgcctcctgttcgccgtggagccggagcgcgtgccctactattcggcggtggca
gttatcggtttgggtaaggaatgcctgggctataacccatacgaggtgctcgacgagcag
aaggaggccatccgacggtcggtagcggatgcctgccgaatactcgctgaactggacacc
gaccgcatcgaagtagagaactgtggacacgccgaatctgccgcggagggagcagctctc
gggatctggatctaccaggagcttcgcgatcccaagcggcgaatctcagtgccttccatc
gatctgtatgccactaaggatgagatttgcgacatagaaggatggcgtatcggcctgcaa
aaggctgccgcgcagaacctgacccgccagttgcaggagatgccctccaaccttttgacc
cccactgcctttgcccagaatgtcgtcgaagtgctttgtaagtccggcgtcaatgtagag
gtcaaagtcgagggttgggctgagagccagtcgatgcacgccttcttggcggtgggaaag
gcctcttgcgaaccaccaatctttctggagctgagctactacggcacctgtgccgaggag
cgacccatcgtcttggttgggcagggagtgacttacgatgcaggtggtttgtgcttaaag
gagaagcaggaacttttccacatgcgcggagatatgactggtgcggccgtagtggtggcc
acttgtcgtgctgtcgctggcctgaggttaccggtcaatattcgtggactaatacccctg
tgcgagaacgttattggatgcaattccttccgtcctggagacatggtgaaatccatgaat
ggcaagaccattgaggtgcagtgcaccgaccacgaagatgttctagtgctggcggatgcc
cttctgtacgggcagaacttctgtccgaagtgcatcattgacattggcacctgctcggga
tatatgcgccaagcgttggatgaggctgcctgtggggtgtttaccaactctgagatcctt
tggcagcagatcaagcacgccagcatgcacactggagaccgcgtgtggcgtttccccctg
tggaactactacagcaaggcggtgcgtgccggtggacgcagtgatgtccagaactacggt
atcggtcgtggtggacgtccttgcaaagctgccgctttccttcgtgaatttgtgccttgc
ggccaatggatgcatattgatgccaccaacgtgatgatcacacgtggtgatgagttcgag
tatctgcgagagggcatggccggacgtccaacaaggacactcatcgagtttattgcacag
tccatatgcaaggacacagctccaaagcttaacaagtga

DBGET integrated database retrieval system